PDB entry 2f27

View 2f27 on RCSB PDB site
Description: Crystal Structure of the Human Sialidase Neu2 E111Q-Q112E Double Mutant in Complex with DANA Inhibitor
Class: hydrolase
Keywords: SIALIDASE, NEURAMINIDASE, GANGLIOSIDE, DRUG DESIGN, hydrolase
Deposited on 2005-11-15, released 2006-11-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.186
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sialidase 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y3R4 (2-End)
      • engineered (112-113)
    Domains in SCOPe 2.07: d2f27a_
  • Chain 'B':
    Compound: Sialidase 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y3R4 (2-End)
      • engineered (112-113)
    Domains in SCOPe 2.07: d2f27b_
  • Heterogens: DAN, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2f27A (A:)
    gsmaslpvlqkesvfqsgahayripallylpgqqsllafaeqraskkdehaelivlrrgd
    ydapthqvqwqaqevvaqarldghrsmnpcplydaqtgtlflffiaipgqvtqeqqlqtr
    anvtrlcqvtstdhgrtwssprdltdaaigpayrewstfavgpghclqlndrarslvvpa
    yayrklhpiqrpipsafcflshdhgrtwarghfvaqdtlecqvaevetgeqrvvtlnars
    hlrarvqaqstndgldfqesqlvkklvepppqgcqgsvisfpsprsgpgspaqwllythp
    thswqradlgaylnprppapeawsepvllakgscaysdlqsmgtgpdgsplfgclyeand
    yeeivflmftlkqafpaeylpq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f27A (A:)
    maslpvlqkesvfqsgahayripallylpgqqsllafaeqraskkdehaelivlrrgdyd
    apthqvqwqaqevvaqarldghrsmnpcplydaqtgtlflffiaipgqvtqeqqlqtran
    vtrlcqvtstdhgrtwssprdltdaaigpayrewstfavgpghclqlndrarslvvpaya
    yrklhpiqrpipsafcflshdhgrtwarghfvaqdtlecqvaeveqrvvtlnarshlrar
    vqaqstndgldfqesqlvkklvepppqgcqgsvisfpsprspaqwllythpthswqradl
    gaylnprppapeawsepvllakgscaysdlqsmgtgpdgsplfgclyeandyeeivflmf
    tlkqafpaey
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2f27B (B:)
    gsmaslpvlqkesvfqsgahayripallylpgqqsllafaeqraskkdehaelivlrrgd
    ydapthqvqwqaqevvaqarldghrsmnpcplydaqtgtlflffiaipgqvtqeqqlqtr
    anvtrlcqvtstdhgrtwssprdltdaaigpayrewstfavgpghclqlndrarslvvpa
    yayrklhpiqrpipsafcflshdhgrtwarghfvaqdtlecqvaevetgeqrvvtlnars
    hlrarvqaqstndgldfqesqlvkklvepppqgcqgsvisfpsprsgpgspaqwllythp
    thswqradlgaylnprppapeawsepvllakgscaysdlqsmgtgpdgsplfgclyeand
    yeeivflmftlkqafpaeylpq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f27B (B:)
    maslpvlqkesvfqsgahayripallylpgqqsllafaeqraskkdehaelivlrrgdyd
    apthqvqwqaqevvaqarldghrsmnpcplydaqtgtlflffiaipgqvtqeqqlqtran
    vtrlcqvtstdhgrtwssprdltdaaigpayrewstfavgpghclqlndrarslvvpaya
    yrklhpiqrpipsafcflshdhgrtwarghfvaqdtlecqvaevetgeqrvvtlnarshl
    rarvqaqstndgldfqesqlvkklvepppqgcqgsvisfpsprspaqwllythpthswqr
    adlgaylnprppapeawsepvllakgscaysdlqsmgtgpdgsplfgclyeandyeeivf
    lmftlkqafpaey