PDB entry 2f1r

View 2f1r on RCSB PDB site
Description: Crystal Structure of molybdopterin-guanine biosynthesis protein B (mobB)
Class: biosynthetic protein
Keywords: Molybdopterin, Structural Genomics, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, BIOSYNTHETIC PROTEIN
Deposited on 2005-11-15, released 2005-12-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.191
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: molybdopterin-guanine dinucleotide biosynthesis protein B (mobB)
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O28031 (3-160)
      • cloning artifact (2)
      • cloning artifact (161)
    Domains in SCOPe 2.07: d2f1ra1, d2f1ra2, d2f1ra3
  • Chain 'B':
    Compound: molybdopterin-guanine dinucleotide biosynthesis protein B (mobB)
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O28031 (3-End)
      • cloning artifact (2)
    Domains in SCOPe 2.07: d2f1rb1, d2f1rb2
  • Heterogens: PR, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2f1rA (A:)
    mslilsivgtsdsgkttlitrmmpilrerglrvavvkrhahgdfeidkegkdswkiynsg
    advviaspvklafirrvseeegndldwiyerylsdydlvitegfskagkdrivvvkkpee
    vehfrqgrilavvcdervdghkwfrrdeveriaefilsllreggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f1rA (A:)
    lilsivgtsdsgkttlitrmmpilrerglrvavvkrkdswkiynsgadvviaspvklafi
    rrvseeegndldwiyerylsdydlvitegfskagkdrivvvkkpeevehfrqgrilavvc
    dervdghkwfrrdeveriaefilsllre
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2f1rB (B:)
    mslilsivgtsdsgkttlitrmmpilrerglrvavvkrhahgdfeidkegkdswkiynsg
    advviaspvklafirrvseeegndldwiyerylsdydlvitegfskagkdrivvvkkpee
    vehfrqgrilavvcdervdghkwfrrdeveriaefilsllreggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f1rB (B:)
    lilsivgtssgkttlitrmmpilrerglrvavvkrhadswkiynsgadvviaspvklafi
    rrvseeegndldwiyerylsdydlvitegfskagkdrivvvkkpeevehfrqgrilavvc
    dervdghkwfrrdeveriaefilsll