PDB entry 2f1j

View 2f1j on RCSB PDB site
Description: Recombinase in Complex with ADP
Class: recombination
Keywords: ATPASE, PROTEIN-ATP COMPLEX, Rad51, RecA, recombinase, RECOMBINATION
Deposited on 2005-11-14, released 2006-05-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.211
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA repair and recombination protein radA
    Species: Methanococcus voltae [TaxId:2188]
    Gene: RADA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O73948 (Start-321)
      • engineered (150)
    Domains in SCOPe 2.06: d2f1ja1, d2f1ja2
  • Heterogens: MG, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2f1jA (A:)
    mgdnltdlpgvgpstaeklveagyidfmkiatatvgeltdiegisekaaakmimgardlc
    dlgfksgidllkqrstvwklstssseldsvlggglesqsvtefagvfgsgktqimhqscv
    nlqnpeflfydeeavskgevaqpkavyidtdgtfrperimqmaehagidgqtvldntfva
    raynsdmqmlfaekiedliqegnniklvvidsltstfrneytgrgklaerqqklgrhmat
    lnkladlfncvvlvtnqvsakpdaffgmaeqaigghivghaatfrffvrkgkgdkrvakl
    ydsphlpdaeaifritekgiqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f1jA (A:)
    ltdlpgvgpstaeklveagyidfmkiatatvgeltdiegisekaaakmimgardlcdlgf
    ksgidllkqrstvwklstssseldsvlggglesqsvtefagvfgsgktqimhqscvnlqn
    peflfydeeavskgevaqpkavyidtdgtfrperimqmaehagidgqtvldntfvarayn
    sdmqmlfaekiedliqegnniklvvidsltstfrneytgrgklaerqqklgrhmatlnkl
    adlfncvvlvtnqvsghaatfrffvrkgkgdkrvaklydsphlpdaeaifritekgiqd