PDB entry 2f19

View 2f19 on RCSB PDB site
Description: three-dimensional structure of two crystal forms of fab r19.9, from a monoclonal anti-arsonate antibody
Deposited on 1992-05-27, released 1992-10-15
The last revision prior to the SCOP 1.71 freeze date was dated 1992-10-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.8 Å
R-factor: 0.182
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f19H (H:)
    qvqlqqsgaelvragssvkmsckasgytftsygvnwvkqrpgqglewigyinpgkgylsy
    nekfkgkttltvdrssstaymqlrsltsedaavyfcarsfyggsdlavyyfdswgqgttl
    tvssakttppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpal
    lqsalytmsssvtvpsstwpsqtvtcsvahpassttvdkkl
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f19L (L:)
    diqmtqttsslsaslgdrvtiscrasqdisnylnwyqqkpdgtvklliyytsrlhsgvps
    rfsgsgsgtdysltisnlehediatyfcqqgstlprtfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec