PDB entry 2f16

View 2f16 on RCSB PDB site
Description: Crystal structure of the yeast 20S proteasome in complex with bortezomib
Class: hydrolase
Keywords: beta-sandwich flanked by helices, complex structure covalently bound to the synthetic inihibtor bortezomib
Deposited on 2005-11-14, released 2006-03-21
The last revision prior to the SCOP 1.73 freeze date was dated 2006-03-21, with a file datestamp of 2007-07-06.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.231
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: Proteasome component PRE4
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2f1611
  • Chain '2':
    Compound: Proteasome component PRE3
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2f1621
  • Chain 'A':
    Compound: Proteasome component Y7
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2f16a1
  • Chain 'B':
    Compound: Proteasome component Y13
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2f16b1
  • Chain 'C':
    Compound: Proteasome component PRE6
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2f16c1
  • Chain 'D':
    Compound: Proteasome component PUP2
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2f16d1
  • Chain 'E':
    Compound: Proteasome component PRE5
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2f16e1
  • Chain 'F':
    Compound: Proteasome component C1
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2f16f1
  • Chain 'G':
    Compound: Proteasome component C7-alpha
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2f16g1
  • Chain 'H':
    Compound: Proteasome component PUP1
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2f16h1
  • Chain 'I':
    Compound: Proteasome component PUP3
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2f16i1
  • Chain 'J':
    Compound: Proteasome component C11
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2f16j1
  • Chain 'K':
    Compound: Proteasome component PRE2
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2f16k1
  • Chain 'L':
    Compound: Proteasome component C5
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2f16l1
  • Chain 'M':
    Compound: Proteasome component PRE4
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2f16m1
  • Chain 'N':
    Compound: Proteasome component PRE3
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2f16n1
  • Chain 'O':
    Compound: Proteasome component Y7
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2f16o1
  • Chain 'P':
    Compound: Proteasome component Y13
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2f16p1
  • Chain 'Q':
    Compound: Proteasome component PRE6
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2f16q1
  • Chain 'R':
    Compound: Proteasome component PUP2
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2f16r1
  • Chain 'S':
    Compound: Proteasome component PRE5
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2f16s1
  • Chain 'T':
    Compound: Proteasome component C1
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2f16t1
  • Chain 'U':
    Compound: Proteasome component C7-alpha
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2f16u1
  • Chain 'V':
    Compound: Proteasome component PUP1
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2f16v1
  • Chain 'W':
    Compound: Proteasome component PUP3
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2f16w1
  • Chain 'X':
    Compound: Proteasome component C11
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2f16x1
  • Chain 'Y':
    Compound: Proteasome component PRE2
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2f16y1
  • Chain 'Z':
    Compound: Proteasome component C5
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2f16z1
  • Heterogens: BO2, HOH

PDB Chain Sequences:

  • Chain '1':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f161 (1:)
    tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm
    qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq
    sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna
    mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakdikgygtqki
    

  • Chain '2':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f162 (2:)
    tsimavtfkdgvilgadsrtttgayianrvtdkltrvhdkiwccrsgsaadtqaiadivq
    yhlelytsqygtpstetaasvfkelcyenkdnltagiivagyddknkgevytiplggsvh
    klpyaiagsgstfiygycdknfrenmskeetvdfikhslsqaikwdgssggvirmvvlta
    agverlifypdeyeql
    

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f16A (A:)
    mtdrysfslttfspsgklgqidyaltavkqgvtslgikatngvviatekksssplamset
    lskvslltpdigavysgmgpdyrvlvdksrkvahtsykriygeypptkllvsevakimqe
    atqsggvrpfgvslliaghdefngfslyqvdpsgsyfpwkataigkgsvaaktflekrwn
    deleledaihialltlkesvegefngdtielaiigdenpdllgytgiptdkgprfrklts
    qeindrleal
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f16B (B:)
    gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt
    steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg
    ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk
    ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk
    tgit
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f16C (C:)
    gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
    kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
    sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
    eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe
    q
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f16D (D:)
    drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
    eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgegas
    geerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewh
    ssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekea
    ae
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f16E (E:)
    frnnydgdtvtfsptgrlfqveyaleaikqgsvtvglrsnthavlvalkrnadelssyqk
    kiikcdehmglslaglapdarvlsnylrqqcnysslvfnrklaveraghllcdkaqkntq
    syggrpygvglliigydksgahllefqpsgnvtelygtaigarsqgaktylertldtfik
    idgnpdelikagveaisqslrdesltvdnlsiaivgkdtpftiydgeavakyi
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f16F (F:)
    gtgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqkn
    vkiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqaht
    lynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhp
    eglsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaq
    kein
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f16G (G:)
    agydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttv
    syifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiyt
    qraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkks
    kidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaia
    eqd
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f16H (H:)
    ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
    snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
    vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
    gkdaeylrnyltpnvreekqksykfprgttavlkesivnicd
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f16I (I:)
    sdpssinggivvamtgkdcvaiacdlrlgsqslgvsnkfekifhyghvflgitglatdvt
    tlnemfryktnlyklkeeraiepetftqlvssslyerrfgpyfvgpvvaginsksgkpfi
    agfdligcideakdfivsgtasdqlfgmceslyepnlepedlfetisqallnaadrdals
    gwgavvyiikkdevvkrylkmrqd
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f16J (J:)
    mdiilgirvqdsvilasskavtrgisvlkdsddktrqlsphtlmsfageagdtvqfaeyi
    qaniqlysiredyelspqavssfvrqelaksirsrrpyqvnvliggydkkknkpelyqid
    ylgtkvelpygahgysgfytfslldhhyrpdmtteegldllklcvqelekrmpmdfkgvi
    vkivdkdgirqvddfqaq
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f16K (K:)
    tttlafrfqggiivavdsratagnwvasqtvkkvieinpfllgtmaggaadcqfwetwlg
    sqcrlhelrekerisvaaaskilsnlvyqykgaglsmgtmicgytrkegptiyyvdsdgt
    rlkgdifcvgsgqtfaygvldsnykwdlsvedalylgkrsilaaahrdaysggsvnlyhv
    tedgwiyhgnhdvgelfwkvkeeegsfnnvig
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f16L (L:)
    qfnpygdnggtilgiagedfavlagdtrnitdysinsryepkvfdcgdnivmsangfaad
    gdalvkrfknsvkwyhfdhndkklsinsaarniqhllygkrffpyyvhtiiagldedgkg
    avysfdpvgsyereqcraggaaaslimpfldnqvnfknqyepgtngkvkkplkylsveev
    iklvrdsftsaterhiqvgdgleilivtkdgvrkefyelkrd
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f16M (M:)
    tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm
    qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq
    sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna
    mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakdikgygtqki
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f16N (N:)
    tsimavtfkdgvilgadsrtttgayianrvtdkltrvhdkiwccrsgsaadtqaiadivq
    yhlelytsqygtpstetaasvfkelcyenkdnltagiivagyddknkgevytiplggsvh
    klpyaiagsgstfiygycdknfrenmskeetvdfikhslsqaikwdgssggvirmvvlta
    agverlifypdeyeql
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f16O (O:)
    mtdrysfslttfspsgklgqidyaltavkqgvtslgikatngvviatekksssplamset
    lskvslltpdigavysgmgpdyrvlvdksrkvahtsykriygeypptkllvsevakimqe
    atqsggvrpfgvslliaghdefngfslyqvdpsgsyfpwkataigkgsvaaktflekrwn
    deleledaihialltlkesvegefngdtielaiigdenpdllgytgiptdkgprfrklts
    qeindrleal
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f16P (P:)
    gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt
    steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg
    ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk
    ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk
    tgit
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f16Q (Q:)
    gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
    kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
    sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
    eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe
    q
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f16R (R:)
    drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
    eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgegas
    geerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewh
    ssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekea
    ae
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f16S (S:)
    frnnydgdtvtfsptgrlfqveyaleaikqgsvtvglrsnthavlvalkrnadelssyqk
    kiikcdehmglslaglapdarvlsnylrqqcnysslvfnrklaveraghllcdkaqkntq
    syggrpygvglliigydksgahllefqpsgnvtelygtaigarsqgaktylertldtfik
    idgnpdelikagveaisqslrdesltvdnlsiaivgkdtpftiydgeavakyi
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f16T (T:)
    gtgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqkn
    vkiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqaht
    lynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhp
    eglsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaq
    kein
    

  • Chain 'U':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f16U (U:)
    agydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttv
    syifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiyt
    qraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkks
    kidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaia
    eqd
    

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f16V (V:)
    ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
    snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
    vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
    gkdaeylrnyltpnvreekqksykfprgttavlkesivnicd
    

  • Chain 'W':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f16W (W:)
    sdpssinggivvamtgkdcvaiacdlrlgsqslgvsnkfekifhyghvflgitglatdvt
    tlnemfryktnlyklkeeraiepetftqlvssslyerrfgpyfvgpvvaginsksgkpfi
    agfdligcideakdfivsgtasdqlfgmceslyepnlepedlfetisqallnaadrdals
    gwgavvyiikkdevvkrylkmrqd
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f16X (X:)
    mdiilgirvqdsvilasskavtrgisvlkdsddktrqlsphtlmsfageagdtvqfaeyi
    qaniqlysiredyelspqavssfvrqelaksirsrrpyqvnvliggydkkknkpelyqid
    ylgtkvelpygahgysgfytfslldhhyrpdmtteegldllklcvqelekrmpmdfkgvi
    vkivdkdgirqvddfqaq
    

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f16Y (Y:)
    tttlafrfqggiivavdsratagnwvasqtvkkvieinpfllgtmaggaadcqfwetwlg
    sqcrlhelrekerisvaaaskilsnlvyqykgaglsmgtmicgytrkegptiyyvdsdgt
    rlkgdifcvgsgqtfaygvldsnykwdlsvedalylgkrsilaaahrdaysggsvnlyhv
    tedgwiyhgnhdvgelfwkvkeeegsfnnvig
    

  • Chain 'Z':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f16Z (Z:)
    qfnpygdnggtilgiagedfavlagdtrnitdysinsryepkvfdcgdnivmsangfaad
    gdalvkrfknsvkwyhfdhndkklsinsaarniqhllygkrffpyyvhtiiagldedgkg
    avysfdpvgsyereqcraggaaaslimpfldnqvnfknqyepgtngkvkkplkylsveev
    iklvrdsftsaterhiqvgdgleilivtkdgvrkefyelkrd