PDB entry 2f13

View 2f13 on RCSB PDB site
Description: Crystal Structure of the Human Sialidase Neu2 in Complex with 2',3'- dihydroxypropyl ether mimetic Inhibitor
Class: hydrolase
Keywords: SIALIDASE, NEURAMINIDASE, INFLUENZA VIRUS, DRUG DESIGN, hydrolase
Deposited on 2005-11-14, released 2006-11-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.26 Å
R-factor: 0.194
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sialidase 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2f13a_
  • Heterogens: PO4, DYM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2f13A (A:)
    gsmaslpvlqkesvfqsgahayripallylpgqqsllafaeqraskkdehaelivlrrgd
    ydapthqvqwqaqevvaqarldghrsmnpcplydaqtgtlflffiaipgqvteqqqlqtr
    anvtrlcqvtstdhgrtwssprdltdaaigpayrewstfavgpghclqlndrarslvvpa
    yayrklhpiqrpipsafcflshdhgrtwarghfvaqdtlecqvaevetgeqrvvtlnars
    hlrarvqaqstndgldfqesqlvkklvepppqgcqgsvisfpsprsgpgspaqwllythp
    thswqradlgaylnprppapeawsepvllakgscaysdlqsmgtgpdgsplfgclyeand
    yeeivflmftlkqafpaeylpq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f13A (A:)
    slpvlqkesvfqsgahayripallylpgqqsllafaeqraaelivlrrgdydapthqvqw
    qaqevvaqarldghrsmnpcplydaqtgtlflffiaipgqranvtrlcqvtstdhgrtws
    sprdltdaaigpayrewstfavgpghclqlndrarslvvpayayrklhpiqrpipsafcf
    lshdhgrtwarghfvaqdtlecqvaeveeqrvvtlnarshlrarvqaqstndgldfqesq
    lvkklvepppqgcqgsvisfpspraqwllythpthswqradlgaylnprppapeawsepv
    llakgscaysdlqsmgtgpdgsplfgclyeandyeeivflmftlkqafpae