PDB entry 2ezk

View 2ezk on RCSB PDB site
Description: solution nmr structure of the ibeta subdomain of the mu end DNA binding domain of phage mu transposase, regularized mean structure
Class: DNA-binding protein
Keywords: DNA-binding protein, transposition, transposable element
Deposited on 1997-10-04, released 1998-01-14
The last revision prior to the SCOP 1.75 freeze date was dated 1998-01-14, with a file datestamp of 2007-06-04.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: transposase
  Species: Bacteriophage Mu
  Database cross-references and differences (RAF-indexed):
  • Uniprot P07636 (1-End)
  Domains in SCOP 1.75: d2ezka_

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2ezkA (A:)
  miarptleahdydrealwskwdnasdsqrrlaekwlpavqaademlnqgistktafatva
  ghyqvsastlrdkyyqvqkfakpdwaaalvdgrgasrrn
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2ezkA (A:)
  miarptleahdydrealwskwdnasdsqrrlaekwlpavqaademlnqgistktafatva
  ghyqvsastlrdkyyqvqkfakpdwaaalvdgr