PDB entry 2eyt

View 2eyt on RCSB PDB site
Description: A structural basis for selection and cross-species reactivity of the semi-invariant NKT cell receptor in CD1d/glycolipid recognition
Class: immune system
Keywords: Natural killer T cell receptor, NKT cell receptor, NKT15, IMMUNE SYSTEM
Deposited on 2005-11-09, released 2006-03-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.21
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nkt15
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2eyta1, d2eyta2
  • Chain 'B':
    Compound: nkt15
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2eytb1, d2eytb2
  • Chain 'C':
    Compound: nkt15
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2eytc1, d2eytc2
  • Chain 'D':
    Compound: nkt15
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2eytd1, d2eytd2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2eytA (A:)
    hmknqveqspqsliilegknctlqcnytvspfsnlrwykqdtgrgpvsltimtfsentks
    ngrytatldadtkqsslhitasqlsdsasyicvvsdrgstlgrlyfgrgtqltvwpdiqn
    pdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsava
    wsnksdfacanafnnsiipedtffpspess
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eytA (A:)
    nqveqspqsliilegknctlqcnytvspfsnlrwykqdtgrgpvsltimtfsentksngr
    ytatldadtkqsslhitasqlsdsasyicvvsdrgstlgrlyfgrgtqltvwpdiqnpdp
    avyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsn
    ksdfacanafnnsiipedtffp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2eytB (B:)
    diyqtprylvigtgkkitlecsqtmghdkmywyqqdpgmelhlihysygvnstekgdlss
    estvsrirtehfpltlesarpshtsqylcassglrdrglyeqyfgpgtrltvtedlknvf
    ppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqp
    alndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawg
    rad
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2eytC (C:)
    hmknqveqspqsliilegknctlqcnytvspfsnlrwykqdtgrgpvsltimtfsentks
    ngrytatldadtkqsslhitasqlsdsasyicvvsdrgstlgrlyfgrgtqltvwpdiqn
    pdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsava
    wsnksdfacanafnnsiipedtffpspess
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eytC (C:)
    nqveqspqsliilegknctlqcnytvspfsnlrwykqdtgrgpvsltimtfsentksngr
    ytatldadtkqsslhitasqlsdsasyicvvsdrgstlgrlyfgrgtqltvwpdiqnpdp
    avyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsn
    ksdfacanafnnsiipedtffp
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2eytD (D:)
    diyqtprylvigtgkkitlecsqtmghdkmywyqqdpgmelhlihysygvnstekgdlss
    estvsrirtehfpltlesarpshtsqylcassglrdrglyeqyfgpgtrltvtedlknvf
    ppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqp
    alndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawg
    rad