PDB entry 2eyi

View 2eyi on RCSB PDB site
Description: Crystal structure of the actin-binding domain of human alpha-actinin 1 at 1.7 Angstrom resolution
Class: structural protein
Keywords: calponin homology domain, CH domain, Structural Protein, Actin-binding, Actin-crosslinking, Actin-bundling
Deposited on 2005-11-09, released 2006-08-29
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.183
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-actinin 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ACTN1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12814 (4-227)
      • cloning artifact (0-3)
      • cloning artifact (228-233)
    Domains in SCOPe 2.05: d2eyia1, d2eyia2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2eyiA (A:)
    aghmekqqrktftawcnshlrkagtqienieedfrdglklmlllevisgerlakpergkm
    rvhkisnvnkaldfiaskgvklvsigaeeivdgnvkmtlgmiwtiilrfaiqdisveets
    akeglllwcqrktapyknvniqnfhiswkdglgfcalihrhrpelidygklrkddpltnl
    ntafdvaekyldipkmldaedivgtarpdekaimtyvssfyhafsgaqeflepg