PDB entry 2ewr

View 2ewr on RCSB PDB site
Description: Crystal structure of a putative nucleotidyltransferase (tm1012) from Thermotoga maritima at 1.60 A resolution
Class: structural genomics, unknown function
Keywords: tm1012, hypothetical protein, Structural Genomics, PSI, Protein Structure Initiative, Joint Center for Structural Genomics, JCSG
Deposited on 2005-11-05, released 2005-12-06
The last revision prior to the SCOP 1.73 freeze date was dated 2005-12-13, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.147
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein TM1012
    Species: Thermotoga maritima
    Gene: tm1012
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0A5
      • modified residue (104)
      • modified residue (134)
    Domains in SCOP 1.73: d2ewra1
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ewrA (A:)
    mgsdkihhhhhhmirpeylrvlrkiydrlknekvnwvvtgslsfalqgvpvevhdidiqt
    deegayeierifsefvskkvrfsstekicshfgeliidgikveimgdirkrledgtwedp
    vdlnkykrfvethgmkipvlsleyeyqaylklgrvekaetlrkwlnerkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ewrA (A:)
    irpeylrvlrkiydrlknekvnwvvtgslsfalqgvpvevhdidiqtdeegayeierifs
    efvskkvrfsstekicshfgeliidgikveimgdirkrledgtwedpvdlnkykrfveth
    gmkipvlsleyeyqaylklgrvekaetlrkwlnerk