PDB entry 2ewa

View 2ewa on RCSB PDB site
Description: Dual binding mode of pyridinylimidazole to MAP kinase p38
Class: transferase
Keywords: MAP kinase, DFG out, TRANSFERASE
Deposited on 2005-11-02, released 2006-08-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.241
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Mus musculus [TaxId:10090]
    Gene: Mapk14, Crk1, Csbp1, Csbp2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P47811
      • conflict (66)
      • conflict (281)
    Domains in SCOPe 2.07: d2ewaa_
  • Heterogens: SB2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ewaA (A:)
    gsshhhhhhssglvprgshmsqerptfyrqelnktiwevperyqnlspvgsgaygsvcaa
    fdtktglrvavkklsrpfqsiihakrtyrelrllkhmkhenviglldvftparsleefnd
    vylvthlmgadlnnivkcqkltddhvqfliyqilrglkyihsadiihrdlkpsnlavned
    celkildfglarhtddemtgyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrt
    lfpgtdhidqlklilrlvgtpgaellkkissesarnyiqsltqmpkmnfanvfiganpla
    vdllekmlvldsdkritaaqalahayfaqyhdpddepvadpydqsfesrdllidewkslt
    ydevisfvpppldqeemes
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ewaA (A:)
    rptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsiih
    akrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnniltddhvqf
    liyqilrglkyihsadiihrdlkpsnlavnedcelkildfgtrwyrapeimlnmhynqtv
    diwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkissesarnyiqsltq
    mpkmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqyhdpddepvadpyd
    qsfesrdllidewksltydevisfvpppld