PDB entry 2evw

View 2evw on RCSB PDB site
Description: Crystal structure analysis of a fluorescent form of H-Ras p21 in complex with R-caged GTP
Class: signaling protein
Keywords: guanine nucleotide binding protein, fluorescence, caged GTP, SIGNALING PROTEIN
Deposited on 2005-11-01, released 2006-05-30
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.05 Å
R-factor: 0.157
AEROSPACI score: 0.92 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'X':
  Compound: gtpase hras
  Species: Homo sapiens [TaxId:9606]
  Gene: HRAS, HRAS1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01112 (0-165)
    • engineered (31)
    • engineered (117)
  Domains in SCOPe 2.03: d2evwx_
• Heterogens: MG, CAG, XY2, HOH

PDB Chain Sequences:

• Chain 'X':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2evwX (X:)
  mteyklvvvgaggvgksaltiqliqnhfvdecdptiedsyrkqvvidgetclldildtag
  qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnksdl
  aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh