PDB entry 2evw

View 2evw on RCSB PDB site
Description: Crystal structure analysis of a fluorescent form of H-Ras p21 in complex with R-caged GTP
Class: signaling protein
Keywords: guanine nucleotide binding protein, fluorescence, caged GTP, SIGNALING PROTEIN
Deposited on 2005-11-01, released 2006-05-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.05 Å
R-factor: N/A
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: gtpase hras
    Species: Homo sapiens [TaxId:9606]
    Gene: HRAS, HRAS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01112 (0-165)
      • engineered (31)
      • engineered (117)
    Domains in SCOPe 2.08: d2evwx_
  • Heterogens: MG, CAG, XY2, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2evwX (X:)
    mteyklvvvgaggvgksaltiqliqnhfvdecdptiedsyrkqvvidgetclldildtag
    qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnksdl
    aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh