PDB entry 2etg

View 2etg on RCSB PDB site
Description: Human sulfotransferase sult1c1 in complex with pap
Class: transferase
Keywords: sulfotransferase , pap, structural genomics, psi, protein structure initiative, structural genomics consortium, sgc
Deposited on 2005-10-27, released 2005-11-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2007-12-04, with a file datestamp of 2007-11-30.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.184
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sulfotransferase 1C1
    Species: HOMO SAPIENS
    Gene: SULT1C1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00338 (Start-295)
      • engineered (292)
    Domains in SCOPe 2.07: d2etga_
  • Chain 'B':
    Compound: Sulfotransferase 1C1
    Species: HOMO SAPIENS
    Gene: SULT1C1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00338 (Start-295)
      • engineered (292)
    Domains in SCOPe 2.07: d2etgb_
  • Heterogens: A3P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2etgA (A:)
    maltsdlgkqiklkevegtllqpatvdnwsqiqsfeakpddllictypkagttwiqeivd
    mieqngdvekcqraiiqhrhpfiewarppqpsgvekakampsprilkthlstqllppsfw
    ennckflyvarnakdcmvsyyhfqrmnhmlpdpgtweeyfetfingkvvwgswfdhvkgw
    wemkdrhqilflfyedikrdpkheirkvmqfmgkkvdetvldkivqetsfekmkenpmtn
    rstvsksildqsissfmrkgtvgdwknhftvaqnerfdeiyrrkmegtsinfsmel
    

    Sequence, based on observed residues (ATOM records): (download)
    >2etgA (A:)
    klkevegtllqpatvdnwsqiqsfeakpddllictypkagttwiqeivdmieqnghpfie
    warppqpsgvekakampsprilkthlstqllppsfwennckflyvarnakdcmvsyyhfq
    rmnhmlpdpgtweeyfetfingkvvwgswfdhvkgwwemkdrhqilflfyedikrdpkhe
    irkvmqfmgkkvdetvldkivqetsfekmkenfmrkgtvgdwknhftvaqnerfdeiyrr
    kmegtsinfsmel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2etgB (B:)
    maltsdlgkqiklkevegtllqpatvdnwsqiqsfeakpddllictypkagttwiqeivd
    mieqngdvekcqraiiqhrhpfiewarppqpsgvekakampsprilkthlstqllppsfw
    ennckflyvarnakdcmvsyyhfqrmnhmlpdpgtweeyfetfingkvvwgswfdhvkgw
    wemkdrhqilflfyedikrdpkheirkvmqfmgkkvdetvldkivqetsfekmkenpmtn
    rstvsksildqsissfmrkgtvgdwknhftvaqnerfdeiyrrkmegtsinfsmel
    

    Sequence, based on observed residues (ATOM records): (download)
    >2etgB (B:)
    klkevegtllqpatvdnwsqiqsfeakpddllictypkagttwiqeivdmieqnghpfie
    warppqpsgvekakampsprilkthlstqllppsfwennckflyvarnakdcmvsyyhfq
    rmnhmlpdpgtweeyfetfingkvvwgswfdhvkgwwemkdrhqilflfyedikrdpkhe
    irkvmqfmgkketvldkivqetsfekmfmrkgtvgdwknhftvaqnerfdeiyrrkmegt
    sinfsmel