PDB entry 2esq

View 2esq on RCSB PDB site
Description: Human Ubiquitin-Conjugating Enzyme (E2) UbcH5b mutant Ser94Gly
Class: Ligase
Keywords: ligase
Deposited on 2005-10-26, released 2005-12-06
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.44 Å
R-factor: 0.175
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ubiquitin-conjugating enzyme e2 d2
    Species: Homo sapiens [TaxId:9606]
    Gene: UBE2D2, UBC4, UBCH5B
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62837 (2-148)
      • cloning artifact (0-1)
      • engineered (95)
    Domains in SCOPe 2.02: d2esqa1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2esqA (A:)
    gamalkrihkelndlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfpt
    dypfkppkvafttriyhpninsngsicldilrsqwgpaltiskvllsicsllcdpnpddp
    lvpeiariyktdrekynriarewtqkyam