PDB entry 2esc

View 2esc on RCSB PDB site
Description: Crystal structure of a 40 KDa protective signalling protein from Bovine (SPC-40) at 2.1 A resolution
Class: signaling protein
Keywords: protective signalling protein, crystal structure,, signaling protein
Deposited on 2005-10-26, released 2005-12-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.176
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chitinase-3-like protein 1
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2esca1, d2esca2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2escA (A:)
    yklicyytswsqyregdgscfpdaidpflcthviysfanisnneidtwewndvtlydtln
    tlknrnpnlktllsvggwnfgserfskiasktqsrrtfiksvppflrthgfdgldlawly
    pgwrdkrhlttlvkemkaefvreaqagteqlllsaavtagkiaidrgydiaqisrhldfi
    slltydfhggwrgtvghhsplfrgnsdgssrfsnadyavsymlrlgapanklvmgiptfg
    rsytlassstrvgapisgpgipgqftkekgilayyeicdflhgatthrfrdqqvpyatkg
    nqwvayddqesvknkarylknrqlagamvwaldlddfrgtfcgqnltfpltsaikdvlar
    v