PDB entry 2ery

View 2ery on RCSB PDB site
Description: The crystal structure of the Ras related protein RRas2 (RRAS2) in the GDP bound state
Class: signaling protein
Keywords: RRAS2, GDP/GTP binding, GTP hydrolysis, Structural Genomics, Structural Genomics Consortium, SGC, SIGNALING PROTEIN
Deposited on 2005-10-25, released 2005-11-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.198
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein R-Ras2
    Species: Homo sapiens [TaxId:9606]
    Gene: RRAS2, TC21
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62070 (2-End)
      • cloning artifact (0-1)
    Domains in SCOPe 2.07: d2erya1, d2erya2
  • Chain 'B':
    Compound: Ras-related protein R-Ras2
    Species: Homo sapiens [TaxId:9606]
    Gene: RRAS2, TC21
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2eryb_
  • Heterogens: MG, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2eryA (A:)
    smqekyrlvvvggggvgksaltiqfiqsyfvtdydptiedsytkqcviddraarldildt
    agqeefgamreqymrtgegfllvfsvtdrgsfeeiykfqrqilrvkdrdefpmilignka
    dldhqrqvtqeegqqlarqlkvtymeasakirmnvdqafhelvrvirkfqeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eryA (A:)
    smqekyrlvvvggggvgksaltiqfiqsyfvtdydptiedsytkqcviddraarldildt
    afgamreqymrtgegfllvfsvtdrgsfeeiykfqrqilrvkdrdefpmilignkadldh
    qrqvtqeegqqlarqlkvtymeasakirmnvdqafhelvrvirkfqe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2eryB (B:)
    smqekyrlvvvggggvgksaltiqfiqsyfvtdydptiedsytkqcviddraarldildt
    agqeefgamreqymrtgegfllvfsvtdrgsfeeiykfqrqilrvkdrdefpmilignka
    dldhqrqvtqeegqqlarqlkvtymeasakirmnvdqafhelvrvirkfqeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eryB (B:)
    ekyrlvvvggggvgksaltiqfiqsyfvtdydptiedsytkqcviddraarldildtagq
    eefgamreqymrtgegfllvfsvtdrgsfeeiykfqrqilrvkdrdefpmilignkadld
    hqrqvtqeegqqlarqlkvtymeasakirmnvdqafhelvrvirkfqeq