PDB entry 2eql

View 2eql on RCSB PDB site
Description: crystallographic studies of a calcium binding lysozyme from equine milk at 2.5 angstroms resolution
Deposited on 1994-05-27, released 1994-07-31
The last revision prior to the SCOP 1.55 freeze date was dated 1994-07-31, with a file datestamp of 1994-08-02.
Experiment type: -
Resolution: 2.5 Å
R-factor: 0.234
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d2eql__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2eql_ (-)
    kvfskcelahklkaqemdgfggyslanwvcmaeyesnfntrafngknangssdyglfqln
    nkwwckdnkrsssnacnimcsklldenidddiscakrvvrdpkgmsawkawvkhckdkdl
    seylascnl