PDB entry 2eqi

View 2eqi on RCSB PDB site
Description: Solution structure of the SH3 domain from Phospholipase C, gamma 2
Class: immune system, hydrolase
Keywords: SH3 domain, Phospholipase C, gamma 2, PLCg2, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, IMMUNE SYSTEM, HYDROLASE
Deposited on 2007-03-30, released 2008-04-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phospholipase C, gamma 2
    Species: Mus musculus [TaxId:10090]
    Gene: Plcg2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8CIH5 (7-62)
      • expression tag (0-6)
      • expression tag (63-68)
    Domains in SCOPe 2.08: d2eqia1, d2eqia2, d2eqia3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2eqiA (A:)
    gssgssgrtvkalydykakrsdeltfcrgalihnvskepggwwkgdygtriqqyfpsnyv
    edisgpssg