PDB entry 2eqb

View 2eqb on RCSB PDB site
Description: Crystal structure of the Rab GTPase Sec4p, the Sec2p GEF domain, and phosphate complex
Class: endocytosis/exocytosis
Keywords: coiled coil, ENDOCYTOSIS/EXOCYTOSIS COMPLEX
Deposited on 2007-03-30, released 2007-05-22
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.273
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein SEC4
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07560 (5-173)
      • cloning artifact (3-4)
    Domains in SCOPe 2.05: d2eqba_
  • Chain 'B':
    Compound: Rab guanine nucleotide exchange factor SEC2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17065 (5-96)
      • cloning artifact (4)
    Domains in SCOPe 2.05: d2eqbb1
  • Chain 'C':
    Compound: Rab guanine nucleotide exchange factor SEC2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17065 (5-96)
      • cloning artifact (4)
    Domains in SCOPe 2.05: d2eqbc_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2eqbA (A:)
    gplgssimkilligdsgvgkscllvrfvedkfnpsfittigidfkiktvdingkkvklql
    wdtagqerfrtittayyrgamgiilvydvtdertftnikqwfktvnehandeaqlllvgn
    ksdmetrvvtadqgealakelgipfiessaknddnvneifftlakliqekidsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eqbA (A:)
    gssimkilligdsgvgkscllvrfvedkfnpsfittigidfkiktvdingkkvklqlwdt
    agqerfrtittayyrgamgiilvydvtdertftnikqwfktvnehandeaqlllvgnksd
    metrvvtadqgealakelgipfiessaknddnvneifftlakliqekidsn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2eqbB (B:)
    gplgsnynqlkedyntlkrelsdrddevkrlrediakenelrtkaeeeadklnkevedlt
    aslfdeannmvadarkekyaieilnkrlteqlrekdt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eqbB (B:)
    snynqlkedyntlkrelsdrddevkrlrediakenelrtkaeeeadklnkevedltaslf
    deannmvadarkekyaieilnkrlteqlrekdt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2eqbC (C:)
    gplgsnynqlkedyntlkrelsdrddevkrlrediakenelrtkaeeeadklnkevedlt
    aslfdeannmvadarkekyaieilnkrlteqlrekdt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eqbC (C:)
    snynqlkedyntlkrelsdrddevkrlrediakenelrtkaeeeadklnkevedltaslf
    deannmvadarkekyaieilnkrlteqlrekdt