PDB entry 2epf

View 2epf on RCSB PDB site
Description: Crystal Structure of Zinc-Bound Pseudecin From Pseudechis Porphyriacus
Class: toxin
Keywords: crisp, snake venom, cng channel, toxin
Deposited on 2007-03-29, released 2008-03-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2010-09-29, with a file datestamp of 2010-09-24.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.222
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pseudecin
    Species: Pseudechis porphyriacus [TaxId:8671]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2epfa1, d2epfa2
  • Chain 'B':
    Compound: Pseudecin
    Species: Pseudechis porphyriacus [TaxId:8671]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2epfb1, d2epfb2
  • Chain 'C':
    Compound: Pseudecin
    Species: Pseudechis porphyriacus [TaxId:8671]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2epfc1, d2epfc2
  • Chain 'D':
    Compound: Pseudecin
    Species: Pseudechis porphyriacus [TaxId:8671]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2epfd1, d2epfd2
  • Heterogens: ZN, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2epfA (A:)
    nkknyqkeivdkhnalrrsvkptarnmlqmkwnshaaqnakrwadrctfahsppntrtvg
    klrcgenifmssqpfpwsgvvqawydeiknfvygigakppgsvighytqvvwykshligc
    asakcssskylyvcqycpagnirgsiatpyksgppcadcpsacvnrlctnpcnynndfsn
    ckslakkskcqtewikkkcpascfchnkii
    

    Sequence, based on observed residues (ATOM records): (download)
    >2epfA (A:)
    nyqkeivdkhnalrrsvkptarnmlqmkwnshaaqnakrwadrctfahsppntrtvgklr
    cgenifmssqpfpwsgvvqawydeiknfvygigakppgsvighytqvvwykshligcasa
    kcssskylyvcqycpagnirgsiatpyksgppcadcpsacvnrlctnpcnynndfsncks
    lakkskcqtewikkkcpascfchnkii
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2epfB (B:)
    nkknyqkeivdkhnalrrsvkptarnmlqmkwnshaaqnakrwadrctfahsppntrtvg
    klrcgenifmssqpfpwsgvvqawydeiknfvygigakppgsvighytqvvwykshligc
    asakcssskylyvcqycpagnirgsiatpyksgppcadcpsacvnrlctnpcnynndfsn
    ckslakkskcqtewikkkcpascfchnkii
    

    Sequence, based on observed residues (ATOM records): (download)
    >2epfB (B:)
    nyqkeivdkhnalrrsvkptarnmlqmkwnshaaqnakrwadrctfahsppntrtvgklr
    cgenifmssqpfpwsgvvqawydeiknfvygigakppgsvighytqvvwykshligcasa
    kcssskylyvcqycpagnirgsiatpyksgppcadcpsacvnrlctnpcnynndfsncks
    lakkskcqtewikkkcpascfchnkii
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2epfC (C:)
    nkknyqkeivdkhnalrrsvkptarnmlqmkwnshaaqnakrwadrctfahsppntrtvg
    klrcgenifmssqpfpwsgvvqawydeiknfvygigakppgsvighytqvvwykshligc
    asakcssskylyvcqycpagnirgsiatpyksgppcadcpsacvnrlctnpcnynndfsn
    ckslakkskcqtewikkkcpascfchnkii
    

    Sequence, based on observed residues (ATOM records): (download)
    >2epfC (C:)
    nyqkeivdkhnalrrsvkptarnmlqmkwnshaaqnakrwadrctfahsppntrtvgklr
    cgenifmssqpfpwsgvvqawydeiknfvygigakppgsvighytqvvwykshligcasa
    kcssskylyvcqycpagnirgsiatpyksgppcadcpsacvnrlctnpcnynndfsncks
    lakkskcqtewikkkcpascfchnkii
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2epfD (D:)
    nkknyqkeivdkhnalrrsvkptarnmlqmkwnshaaqnakrwadrctfahsppntrtvg
    klrcgenifmssqpfpwsgvvqawydeiknfvygigakppgsvighytqvvwykshligc
    asakcssskylyvcqycpagnirgsiatpyksgppcadcpsacvnrlctnpcnynndfsn
    ckslakkskcqtewikkkcpascfchnkii
    

    Sequence, based on observed residues (ATOM records): (download)
    >2epfD (D:)
    nyqkeivdkhnalrrsvkptarnmlqmkwnshaaqnakrwadrctfahsppntrtvgklr
    cgenifmssqpfpwsgvvqawydeiknfvygigakppgsvighytqvvwykshligcasa
    kcssskylyvcqycpagnirgsiatpyksgppcadcpsacvnrlctnpcnynndfsncks
    lakkskcqtewikkkcpascfchnkii