PDB entry 2eo9

View 2eo9 on RCSB PDB site
Description: Solution structure of the fifth ig-like domain from human Roundabout homo1
Class: cell adheasion
Keywords: beta-sandwich, ig-fold, H-Robo-1, Deleted in U twenty twenty, Neurogenesis, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, CELL ADHEASION
Deposited on 2007-03-29, released 2007-10-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: roundabout homolog 1
  Species: Homo sapiens [TaxId:9606]
  Gene: ROBO1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9Y6N7 (7-117)
    • expression tag (0-6)
  Domains in SCOPe 2.07: d2eo9a1, d2eo9a2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2eo9A (A:)
  gssgssgppvirqgpvnqtvavdgtfvlscvatgspvptilwrkdgvlvstqdsrikqle
  ngvlqiryaklgdtgrytciastpsgeatwsayievqefgvpvqpprptdpnlipsap