PDB entry 2eo1

View 2eo1 on RCSB PDB site
Description: Solution structure of the ig domain of human OBSCN protein
Class: contractile protein
Keywords: beta-sandwich, ig-fold, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, CONTRACTILE PROTEIN
Deposited on 2007-03-28, released 2007-10-02
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: CDNA FLJ14124 fis, clone MAMMA1002498
  Species: Homo sapiens [TaxId:9606]
  Gene: OBSCN
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9H7X6 (7-101)
    • expression tag (0-6)
  Domains in SCOPe 2.04: d2eo1a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2eo1A (A:)
  gssgssgkvvfakeqpahrevqaeagasatlscevaqaqtevtwykdgkklsssskvrve
  avgctrrlvvqqagqaeageysceaggqqlsfrlqvagqcfg