PDB entry 2enm

View 2enm on RCSB PDB site
Description: Solution structure of the SH3 domain from mouse sorting nexin-9
Class: endocytosis
Keywords: SH3-like barrel, Protein transport, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, ENDOCYTOSIS
Deposited on 2007-03-28, released 2007-10-02
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Sorting nexin-9
  Species: Mus musculus [TaxId:10090]
  Gene: Snx9
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q91VH2 (7-76)
    • expression tag (0-6)
  Domains in SCOPe 2.05: d2enma_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2enmA (A:)
  gssgssgmatkarvmydfaaepgnneltvtegeiitvtnpnvgggwlegknnkgeqglvp
  tdyveilpndgkdpfsc