PDB entry 2enb

View 2enb on RCSB PDB site
Description: crystal structures of the binary ca2+ and pdtp complexes and the ternary complex of the asp 21->glu mutant of staphylococcal nuclease. implications for catalysis and ligand binding
Deposited on 1994-03-23, released 1994-05-31
The last revision prior to the SCOP 1.65 freeze date was dated 1994-05-31, with a file datestamp of 1994-06-07.
Experiment type: -
Resolution: 2.05 Å
R-factor: 0.177
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.65: d2enb__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2enb_ (-)
  lhkepatlikaidgetvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasaftkkmv
  enakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnntheqhlr
  kseaqakkeklniws