PDB entry 2ekn

View 2ekn on RCSB PDB site
Description: Structure of PH1811 protein from Pyrococcus horikoshii
Class: biosynthetic protein
Keywords: molybdenum cofactor biosynthesis protein, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, BIOSYNTHETIC PROTEIN
Deposited on 2007-03-23, released 2008-04-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.19
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable molybdenum cofactor biosynthesis protein C
    Species: Pyrococcus horikoshii [TaxId:70601]
    Gene: moaC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ekna_
  • Chain 'B':
    Compound: Probable molybdenum cofactor biosynthesis protein C
    Species: Pyrococcus horikoshii [TaxId:70601]
    Gene: moaC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2eknb_
  • Chain 'C':
    Compound: Probable molybdenum cofactor biosynthesis protein C
    Species: Pyrococcus horikoshii [TaxId:70601]
    Gene: moaC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2eknc_
  • Heterogens: FLC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2eknA (A:)
    mvgglthvdekgvkmveigykdvvfrkavakgriklkpetvklikegkiekgnvlataqi
    agilavkrtpeliplchpipitgvditfdfgedyievtcevrayyktgvemealtgvtva
    llaiwdmvkavekdekgqypytrienvhvvekvkthnsq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eknA (A:)
    gvkmveigykdvvfrkavakgriklkpetvklikegkiekgnvlataqiagilavkrtpe
    liplchpipitgvditfdfgedyievtcevrayyktgvemealtgvtvallaiwdmvkav
    ekdekgqypytrienvhvvekvkth
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2eknB (B:)
    mvgglthvdekgvkmveigykdvvfrkavakgriklkpetvklikegkiekgnvlataqi
    agilavkrtpeliplchpipitgvditfdfgedyievtcevrayyktgvemealtgvtva
    llaiwdmvkavekdekgqypytrienvhvvekvkthnsq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eknB (B:)
    vkmveigykdvvfrkavakgriklkpetvklikegkiekgnvlataqiagilavkrtpel
    iplchpipitgvditfdfgedyievtcevrayyktgvemealtgvtvallaiwdmvkave
    kdekgqypytrienvhvvekvkthn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2eknC (C:)
    mvgglthvdekgvkmveigykdvvfrkavakgriklkpetvklikegkiekgnvlataqi
    agilavkrtpeliplchpipitgvditfdfgedyievtcevrayyktgvemealtgvtva
    llaiwdmvkavekdekgqypytrienvhvvekvkthnsq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eknC (C:)
    vkmveigykdvvfrkavakgriklkpetvklikegkiekgnvlataqiagilavkrtpel
    iplchpipitgvditfdfgedyievtcevrayyktgvemealtgvtvallaiwdmvkave
    kdekgqypytrienvhvvekvkthn