PDB entry 2ek6

View 2ek6 on RCSB PDB site
Description: Crystal structure of Human RNA-Binding Protein 12
Class: RNA binding protein
Keywords: inter-molecular disulfide, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN
Deposited on 2007-03-22, released 2007-09-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.38 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA-binding protein 12
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NTZ6 (Start-88)
      • expression tag (89-91)
    Domains in SCOPe 2.07: d2ek6a1, d2ek6a2
  • Chain 'B':
    Compound: RNA-binding protein 12
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NTZ6 (Start-88)
      • expression tag (89-91)
    Domains in SCOPe 2.07: d2ek6b1, d2ek6b2
  • Chain 'C':
    Compound: RNA-binding protein 12
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NTZ6 (Start-88)
      • expression tag (89-91)
    Domains in SCOPe 2.07: d2ek6c1, d2ek6c2
  • Chain 'D':
    Compound: RNA-binding protein 12
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NTZ6 (Start-88)
      • expression tag (89-91)
    Domains in SCOPe 2.07: d2ek6d1, d2ek6d2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ek6A (A:)
    gssgssgsssgkpgptvikvqnmpftvsideildffygyqvipgsvclkynekgmptgea
    mvafesrdeataavidlndrpigsrkvklsgpssg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ek6A (A:)
    ptvikvqnmpftvsideildffygyqvipgsvclkynekgmptgeamvafesrdeataav
    idlndrpigsrkvklsgp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ek6B (B:)
    gssgssgsssgkpgptvikvqnmpftvsideildffygyqvipgsvclkynekgmptgea
    mvafesrdeataavidlndrpigsrkvklsgpssg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ek6B (B:)
    ptvikvqnmpftvsideildffygyqvipgsvclkynekgmptgeamvafesrdeataav
    idlndrpigsrkvklsgp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ek6C (C:)
    gssgssgsssgkpgptvikvqnmpftvsideildffygyqvipgsvclkynekgmptgea
    mvafesrdeataavidlndrpigsrkvklsgpssg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ek6C (C:)
    ptvikvqnmpftvsideildffygyqvipgsvclkynekgmptgeamvafesrdeataav
    idlndrpigsrkvklsgp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ek6D (D:)
    gssgssgsssgkpgptvikvqnmpftvsideildffygyqvipgsvclkynekgmptgea
    mvafesrdeataavidlndrpigsrkvklsgpssg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ek6D (D:)
    ptvikvqnmpftvsideildffygyqvipgsvclkynekgmptgeamvafesrdeataav
    idlndrpigsrkvklsgp