PDB entry 2ej2

View 2ej2 on RCSB PDB site
Description: Crystal Structure of T.th.HB8 Branched-Chain Amino Acid Aminotransferase Complexed with N-(5'-Phosphopyridoxyl)-L-Glutamate
Class: transferase
Keywords: PLP-dependent enzyme, TRANSFERASE
Deposited on 2007-03-14, released 2008-03-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.19
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: branched-chain amino acid aminotransferase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ej2a_
  • Chain 'B':
    Compound: branched-chain amino acid aminotransferase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ej2b_
  • Chain 'C':
    Compound: branched-chain amino acid aminotransferase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ej2c_
  • Chain 'D':
    Compound: branched-chain amino acid aminotransferase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ej2d_
  • Chain 'E':
    Compound: branched-chain amino acid aminotransferase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ej2e_
  • Chain 'F':
    Compound: branched-chain amino acid aminotransferase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ej2f_
  • Heterogens: PPE, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ej2A (A:)
    mqikagliwmngafvpqeeaktsvlshalhygtsvfegirayetakgpaifrlkehvkrf
    ynsakvlrmeipfapeeleeaikevvrrngyrscyirplawmgakalgvnplpnnpaevm
    vaawewgaylgeeavrkgarlitsswarfpanvmpgkakvggnyvnsalakmeavaagad
    eallldeegyvaegsgenlffvrdgviyalehsvnlegitrdsviriakdlgyevqvvra
    trdqlymadevfmtgtaaevtpvsmidwrpigkgtagpvalrlrevyleavtgrrpeyeg
    wltyvngq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ej2A (A:)
    qikagliwmngafvpqeeaktsvlshalhygtsvfegirayetakgpaifrlkehvkrfy
    nsakvlrmeipfapeeleeaikevvrrngyrscyirplawmgakalgvnplpnnpaevmv
    aawewgarlitsswarfpanvmpgkakvggnyvnsalakmeavaagadeallldeegyva
    egsgenlffvrdgviyalehsvnlegitrdsviriakdlgyevqvvratrdqlymadevf
    mtgtaaevtpvsmidwrpigkgtagpvalrlrevyleavtgrrpeyegwltyvn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ej2B (B:)
    mqikagliwmngafvpqeeaktsvlshalhygtsvfegirayetakgpaifrlkehvkrf
    ynsakvlrmeipfapeeleeaikevvrrngyrscyirplawmgakalgvnplpnnpaevm
    vaawewgaylgeeavrkgarlitsswarfpanvmpgkakvggnyvnsalakmeavaagad
    eallldeegyvaegsgenlffvrdgviyalehsvnlegitrdsviriakdlgyevqvvra
    trdqlymadevfmtgtaaevtpvsmidwrpigkgtagpvalrlrevyleavtgrrpeyeg
    wltyvngq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ej2B (B:)
    qikagliwmngafvpqeeaktsvlshalhygtsvfegirayetakgpaifrlkehvkrfy
    nsakvlrmeipfapeeleeaikevvrrngyrscyirplawmgakalgvnplpnnpaevmv
    aawewgaylgeeavrkgarlitsswarfpanvmpgkakvggnyvnsalakmeavaagade
    allldeegyvaegsgenlffvrdgviyalehsvnlegitrdsviriakdlgyevqvvrat
    rdqlymadevfmtgtaaevtpvsmidwrpigkgtagpvalrlrevyleavtgrrpeyegw
    ltyvn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ej2C (C:)
    mqikagliwmngafvpqeeaktsvlshalhygtsvfegirayetakgpaifrlkehvkrf
    ynsakvlrmeipfapeeleeaikevvrrngyrscyirplawmgakalgvnplpnnpaevm
    vaawewgaylgeeavrkgarlitsswarfpanvmpgkakvggnyvnsalakmeavaagad
    eallldeegyvaegsgenlffvrdgviyalehsvnlegitrdsviriakdlgyevqvvra
    trdqlymadevfmtgtaaevtpvsmidwrpigkgtagpvalrlrevyleavtgrrpeyeg
    wltyvngq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ej2C (C:)
    qikagliwmngafvpqeeaktsvlshalhygtsvfegirayetakgpaifrlkehvkrfy
    nsakvlrmeipfapeeleeaikevvrrngyrscyirplawmgakalgvnplpnnpaevmv
    aawewvrkgarlitsswarfpanvmpgkakvggnyvnsalakmeavaagadeallldeeg
    yvaegsgenlffvrdgviyalehsvnlegitrdsviriakdlgyevqvvratrdqlymad
    evfmtgtaaevtpvsmidwrpigkgtagpvalrlrevyleavtgrrpeyegwltyvn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ej2D (D:)
    mqikagliwmngafvpqeeaktsvlshalhygtsvfegirayetakgpaifrlkehvkrf
    ynsakvlrmeipfapeeleeaikevvrrngyrscyirplawmgakalgvnplpnnpaevm
    vaawewgaylgeeavrkgarlitsswarfpanvmpgkakvggnyvnsalakmeavaagad
    eallldeegyvaegsgenlffvrdgviyalehsvnlegitrdsviriakdlgyevqvvra
    trdqlymadevfmtgtaaevtpvsmidwrpigkgtagpvalrlrevyleavtgrrpeyeg
    wltyvngq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ej2D (D:)
    qikagliwmngafvpqeeaktsvlshalhygtsvfegirayetakgpaifrlkehvkrfy
    nsakvlrmeipfapeeleeaikevvrrngyrscyirplawmgakalgvnplpnnpaevmv
    aawewgaylvrkgarlitsswarfpanvmpgkakvggnyvnsalakmeavaagadealll
    deegyvaegsgenlffvrdgviyalehsvnlegitrdsviriakdlgyevqvvratrdql
    ymadevfmtgtaaevtpvsmidwrpigkgtagpvalrlrevyleavtgrrpeyegwltyv
    n
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2ej2E (E:)
    mqikagliwmngafvpqeeaktsvlshalhygtsvfegirayetakgpaifrlkehvkrf
    ynsakvlrmeipfapeeleeaikevvrrngyrscyirplawmgakalgvnplpnnpaevm
    vaawewgaylgeeavrkgarlitsswarfpanvmpgkakvggnyvnsalakmeavaagad
    eallldeegyvaegsgenlffvrdgviyalehsvnlegitrdsviriakdlgyevqvvra
    trdqlymadevfmtgtaaevtpvsmidwrpigkgtagpvalrlrevyleavtgrrpeyeg
    wltyvngq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ej2E (E:)
    qikagliwmngafvpqeeaktsvlshalhygtsvfegirayetakgpaifrlkehvkrfy
    nsakvlrmeipfapeeleeaikevvrrngyrscyirplawmgakalgvnplpnnpaevmv
    aawewavrkgarlitsswarfpanvmpgkakvggnyvnsalakmeavaagadeallldee
    gyvaegsgenlffvrdgviyalehsvnlegitrdsviriakdlgyevqvvratrdqlyma
    devfmtgtaaevtpvsmidwrpigkgtagpvalrlrevyleavtgrrpeyegwltyvn
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2ej2F (F:)
    mqikagliwmngafvpqeeaktsvlshalhygtsvfegirayetakgpaifrlkehvkrf
    ynsakvlrmeipfapeeleeaikevvrrngyrscyirplawmgakalgvnplpnnpaevm
    vaawewgaylgeeavrkgarlitsswarfpanvmpgkakvggnyvnsalakmeavaagad
    eallldeegyvaegsgenlffvrdgviyalehsvnlegitrdsviriakdlgyevqvvra
    trdqlymadevfmtgtaaevtpvsmidwrpigkgtagpvalrlrevyleavtgrrpeyeg
    wltyvngq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ej2F (F:)
    qikagliwmngafvpqeeaktsvlshalhygtsvfegirayetakgpaifrlkehvkrfy
    nsakvlrmeipfapeeleeaikevvrrngyrscyirplawmgakalgvnplpnnpaevmv
    aawewavrkgarlitsswarfpanvmpgkakvggnyvnsalakmeavaagadeallldee
    gyvaegsgenlffvrdgviyalehsvnlegitrdsviriakdlgyevqvvratrdqlyma
    devfmtgtaaevtpvsmidwrpigkgtagpvalrlrevyleavtgrrpeyegwltyvn