PDB entry 2eiy

View 2eiy on RCSB PDB site
Description: Crystal Structure of T.th.HB8 Branched-Chain Amino Acid Aminotransferase Complexed with 4-Methylvaleric Acid
Class: transferase
Keywords: PLP-dependent enzyme, TRANSFERASE
Deposited on 2007-03-14, released 2008-03-18
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.189
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: branched-chain amino acid aminotransferase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2eiya_
  • Chain 'B':
    Compound: branched-chain amino acid aminotransferase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2eiyb_
  • Chain 'C':
    Compound: branched-chain amino acid aminotransferase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2eiyc_
  • Heterogens: PLP, 4MV, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2eiyA (A:)
    mqikagliwmngafvpqeeaktsvlshalhygtsvfegirayetakgpaifrlkehvkrf
    ynsakvlrmeipfapeeleeaikevvrrngyrscyirplawmgakalgvnplpnnpaevm
    vaawewgaylgeeavrkgarlitsswarfpanvmpgkakvggnyvnsalakmeavaagad
    eallldeegyvaegsgenlffvrdgviyalehsvnlegitrdsviriakdlgyevqvvra
    trdqlymadevfmtgtaaevtpvsmidwrpigkgtagpvalrlrevyleavtgrrpeyeg
    wltyvngq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eiyA (A:)
    qikagliwmngafvpqeeaktsvlshalhygtsvfegirayetakgpaifrlkehvkrfy
    nsakvlrmeipfapeeleeaikevvrrngyrscyirplawmgakalgvnplpnnpaevmv
    aawewvrkgarlitsswarfpanvmpgkakvggnyvnsalakmeavaagadeallldeeg
    yvaegsgenlffvrdgviyalehsvnlegitrdsviriakdlgyevqvvratrdqlymad
    evfmtgtaaevtpvsmidwrpigkgtagpvalrlrevyleavtgrrpeyegwltyvn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2eiyB (B:)
    mqikagliwmngafvpqeeaktsvlshalhygtsvfegirayetakgpaifrlkehvkrf
    ynsakvlrmeipfapeeleeaikevvrrngyrscyirplawmgakalgvnplpnnpaevm
    vaawewgaylgeeavrkgarlitsswarfpanvmpgkakvggnyvnsalakmeavaagad
    eallldeegyvaegsgenlffvrdgviyalehsvnlegitrdsviriakdlgyevqvvra
    trdqlymadevfmtgtaaevtpvsmidwrpigkgtagpvalrlrevyleavtgrrpeyeg
    wltyvngq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eiyB (B:)
    ikagliwmngafvpqeeaktsvlshalhygtsvfegirayetakgpaifrlkehvkrfyn
    sakvlrmeipfapeeleeaikevvrrngyrscyirplawmgakalgvnplpnnpaevmva
    awewgaylgeeavrkgarlitsswarfpanvmpgkakvggnyvnsalakmeavaagadea
    llldeegyvaegsgenlffvrdgviyalehsvnlegitrdsviriakdlgyevqvvratr
    dqlymadevfmtgtaaevtpvsmidwrpigkgtagpvalrlrevyleavtgrrpeyegwl
    tyvn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2eiyC (C:)
    mqikagliwmngafvpqeeaktsvlshalhygtsvfegirayetakgpaifrlkehvkrf
    ynsakvlrmeipfapeeleeaikevvrrngyrscyirplawmgakalgvnplpnnpaevm
    vaawewgaylgeeavrkgarlitsswarfpanvmpgkakvggnyvnsalakmeavaagad
    eallldeegyvaegsgenlffvrdgviyalehsvnlegitrdsviriakdlgyevqvvra
    trdqlymadevfmtgtaaevtpvsmidwrpigkgtagpvalrlrevyleavtgrrpeyeg
    wltyvngq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eiyC (C:)
    ikagliwmngafvpqeeaktsvlshalhygtsvfegirayetakgpaifrlkehvkrfyn
    sakvlrmeipfapeeleeaikevvrrngyrscyirplawmgakalgvnplpnnpaevmva
    awewkgarlitsswarfpanvmpgkakvggnyvnsalakmeavaagadeallldeegyva
    egsgenlffvrdgviyalehsvnlegitrdsviriakdlgyevqvvratrdqlymadevf
    mtgtaaevtpvsmidwrpigkgtagpvalrlrevyleavtgrrpeyegwltyvn