PDB entry 2eiq

View 2eiq on RCSB PDB site
Description: Design of Disulfide-linked Thioredoxin Dimers and Multimers Through Analysis of Crystal Contacts
Class: electron transport
Keywords: thioredoxin, mutant, di-sulfide bond, electron transport
Deposited on 2007-03-13, released 2007-09-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.187
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thioredoxin 1
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AA25 (0-End)
      • engineered (88)
    Domains in SCOPe 2.07: d2eiqa_
  • Chain 'B':
    Compound: Thioredoxin 1
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AA25 (0-End)
      • engineered (88)
    Domains in SCOPe 2.07: d2eiqb_
  • Heterogens: CU, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2eiqA (A:)
    sdkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklni
    dqnpgtapkygirgiptlllfkngevaackvgalskgqlkefldanla
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eiqA (A:)
    sdkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklni
    dqnpgtapkygirgiptlllfkngevaackvgalskgqlkefldanl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2eiqB (B:)
    sdkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklni
    dqnpgtapkygirgiptlllfkngevaackvgalskgqlkefldanla
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eiqB (B:)
    sdkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklni
    dqnpgtapkygirgiptlllfkngevaackvgalskgqlkefldanl