PDB entry 2eio

View 2eio on RCSB PDB site
Description: Design of Disulfide-linked Thioredoxin Dimers and Multimers Through Analysis of Crystal Contacts
Class: electron transport
Keywords: thioredoxin, mutant, di-sulfide bond, electron transport
Deposited on 2007-03-13, released 2007-09-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.231
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thioredoxin 1
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AA25 (Start-107)
      • engineered (100)
    Domains in SCOPe 2.07: d2eioa_
  • Chain 'B':
    Compound: Thioredoxin 1
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AA25 (Start-107)
      • engineered (100)
    Domains in SCOPe 2.07: d2eiob_
  • Chain 'C':
    Compound: Thioredoxin 1
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AA25 (Start-107)
      • engineered (100)
    Domains in SCOPe 2.07: d2eioc_
  • Chain 'D':
    Compound: Thioredoxin 1
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AA25 (Start-107)
      • engineered (100)
    Domains in SCOPe 2.07: d2eiod_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2eioA (A:)
    sdkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklni
    dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkcfldanla
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eioA (A:)
    dkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklnid
    qnpgtapkygirgiptlllfkngevaatkvgalskgqlkcfldanla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2eioB (B:)
    sdkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklni
    dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkcfldanla
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eioB (B:)
    dkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklnid
    qnpgtapkygirgiptlllfkngevaatkvgalskgqlkcfldanla
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2eioC (C:)
    sdkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklni
    dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkcfldanla
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eioC (C:)
    dkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklnid
    qnpgtapkygirgiptlllfkngevaatkvgalskgqlkcfldanla
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2eioD (D:)
    sdkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklni
    dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkcfldanla
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eioD (D:)
    dkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklnid
    qnpgtapkygirgiptlllfkngevaatkvgalskgqlkcfldanla