PDB entry 2ein

View 2ein on RCSB PDB site
Description: Zinc ion binding structure of bovine heart cytochrome C oxidase in the fully oxidized state
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2007-03-13, released 2007-05-29
The last revision prior to the SCOP 1.75 freeze date was dated 2007-05-29, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.208
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c oxidase subunit 1
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00396 (0-513)
      • modified residue (0)
    Domains in SCOP 1.75: d2eina1
  • Chain 'B':
    Compound: Cytochrome c oxidase subunit 2
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68530 (0-226)
      • modified residue (0)
    Domains in SCOP 1.75: d2einb1, d2einb2
  • Chain 'C':
    Compound: Cytochrome c oxidase subunit 3
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2einc1
  • Chain 'D':
    Compound: Cytochrome c oxidase subunit 4 isoform 1
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2eind1
  • Chain 'E':
    Compound: Cytochrome c oxidase polypeptide Va
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2eine1
  • Chain 'F':
    Compound: Cytochrome c oxidase polypeptide Vb
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2einf1
  • Chain 'G':
    Compound: Cytochrome c oxidase polypeptide VIa-heart
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07471 (0-End)
      • modified residue (10)
    Domains in SCOP 1.75: d2eing1
  • Chain 'H':
    Compound: Cytochrome c oxidase subunit VIb isoform 1
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2einh1
  • Chain 'I':
    Compound: Cytochrome c oxidase polypeptide VIc
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04038 (0-72)
      • modified residue (0)
    Domains in SCOP 1.75: d2eini1
  • Chain 'J':
    Compound: Cytochrome c oxidase polypeptide VIIa-heart
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2einj1
  • Chain 'K':
    Compound: Cytochrome c oxidase polypeptide VIIb
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2eink1
  • Chain 'L':
    Compound: Cytochrome c oxidase polypeptide VIIc
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2einl1
  • Chain 'M':
    Compound: Cytochrome c oxidase polypeptide VIII-heart
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2einm1
  • Chain 'N':
    Compound: Cytochrome c oxidase subunit 1
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00396 (0-513)
      • modified residue (0)
    Domains in SCOP 1.75: d2einn1
  • Chain 'O':
    Compound: Cytochrome c oxidase subunit 2
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68530 (0-226)
      • modified residue (0)
    Domains in SCOP 1.75: d2eino1, d2eino2
  • Chain 'P':
    Compound: Cytochrome c oxidase subunit 3
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2einp1
  • Chain 'Q':
    Compound: Cytochrome c oxidase subunit 4 isoform 1
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2einq1
  • Chain 'R':
    Compound: Cytochrome c oxidase polypeptide Va
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2einr1
  • Chain 'S':
    Compound: Cytochrome c oxidase polypeptide Vb
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2eins1
  • Chain 'T':
    Compound: Cytochrome c oxidase polypeptide VIa-heart
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07471 (0-End)
      • modified residue (10)
    Domains in SCOP 1.75: d2eint1
  • Chain 'U':
    Compound: Cytochrome c oxidase subunit VIb isoform 1
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2einu1
  • Chain 'V':
    Compound: Cytochrome c oxidase polypeptide VIc
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04038 (0-72)
      • modified residue (0)
    Domains in SCOP 1.75: d2einv1
  • Chain 'W':
    Compound: Cytochrome c oxidase polypeptide VIIa-heart
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2einw1
  • Chain 'X':
    Compound: Cytochrome c oxidase polypeptide VIIb
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2einx1
  • Chain 'Y':
    Compound: Cytochrome c oxidase polypeptide VIIc
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2einy1
  • Chain 'Z':
    Compound: Cytochrome c oxidase polypeptide VIII-heart
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2einz1
  • Heterogens: DMU, CU, ZN, MG, NA, HEA, CUA, TGL, PGV, CHD, PSC, PEK, CDL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2einA (A:)
    mfinrwlfstnhkdigtlyllfgawagmvgtalslliraelgqpgtllgddqiynvvvta
    hafvmiffmvmpimiggfgnwlvplmigapdmafprmnnmsfwllppsfllllassmvea
    gagtgwtvypplagnlahagasvdltifslhlagvssilgainfittiinmkppamsqyq
    tplfvwsvmitavllllslpvlaagitmlltdrnlnttffdpagggdpilyqhlfwffgh
    pevyililpgfgmishivtyysgkkepfgymgmvwammsigflgfivwahhmftvgmdvd
    trayftsatmiiaiptgvkvfswlatlhggnikwspammwalgfiflftvggltgivlan
    ssldivlhdtyyvvahfhyvlsmgavfaimggfvhwfplfsgytlndtwakihfaimfvg
    vnmtffpqhflglsgmprrysdypdaytmwntissmgsfisltavmlmvfiiweafaskr
    evltvdltttnlewlngcpppyhtfeeptyvnlk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2einB (B:)
    maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe
    vetiwtilpaiililialpslrilymmdeinnpsltvktmghqwywsyeytdyedlsfds
    ymiptselkpgelrllevdnrvvlpmemtirmlvssedvlhswavpslglktdaipgrln
    qttlmssrpglyygqcseicgsnhsfmpivlelvplkyfekwsasml
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2einC (C:)
    mthqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrd
    virestfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptg
    ihplnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqase
    yyeapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaaw
    ywhfvdvvwlflyvsiywwgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2einC (C:)
    hqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvi
    restfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgih
    plnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyy
    eapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawyw
    hfvdvvwlflyvsiywwgs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2einD (D:)
    ahgsvvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvely
    rlkfkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqt
    krmldmkvapiqgfsakwdydknewkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2einD (D:)
    svvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvelyrlk
    fkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqtkrm
    ldmkvapiqgfsakwdydknewkk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2einE (E:)
    shgshetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlnd
    fasavrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2einE (E:)
    hetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasa
    vrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2einF (F:)
    asgggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgc
    iceednstviwfwlhkgeaqrcpscgthyklvphqlah
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2einG (G:)
    asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
    swgdgnhtffhnprvnplptgyekp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2einG (G:)
    asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
    swgdgnhtffhnprvnplptgyek
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2einH (H:)
    aediqakiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvy
    kslcpiswvstwddrraegtfpgki
    

    Sequence, based on observed residues (ATOM records): (download)
    >2einH (H:)
    kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi
    swvstwddrraegtfpgki
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2einI (I:)
    stalakpqmrgllarrlrfhivgafmvslgfatfykfavaekrkkayadfyrnydsmkdf
    eemrkagifqsak
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2einJ (J:)
    fenrvaekqklfqednglpvhlkggatdnilyrvtmtlclggtlyslyclgwasfphkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2einJ (J:)
    fenrvaekqklfqednglpvhlkggatdnilyrvtmtlclggtlyslyclgwasfphk
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2einK (K:)
    ihqkrapdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewreq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2einK (K:)
    apdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewr
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2einL (L:)
    shyeegpgknipfsvenkwrllammtlffgsgfaapffivrhqllkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2einL (L:)
    hyeegpgknipfsvenkwrllammtlffgsgfaapffivrhqllkk
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2einM (M:)
    itakpaktptspkeqaiglsvtflsfllpagwvlyhldnykkssaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2einM (M:)
    itakpaktptspkeqaiglsvtflsfllpagwvlyhldnykks
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2einN (N:)
    mfinrwlfstnhkdigtlyllfgawagmvgtalslliraelgqpgtllgddqiynvvvta
    hafvmiffmvmpimiggfgnwlvplmigapdmafprmnnmsfwllppsfllllassmvea
    gagtgwtvypplagnlahagasvdltifslhlagvssilgainfittiinmkppamsqyq
    tplfvwsvmitavllllslpvlaagitmlltdrnlnttffdpagggdpilyqhlfwffgh
    pevyililpgfgmishivtyysgkkepfgymgmvwammsigflgfivwahhmftvgmdvd
    trayftsatmiiaiptgvkvfswlatlhggnikwspammwalgfiflftvggltgivlan
    ssldivlhdtyyvvahfhyvlsmgavfaimggfvhwfplfsgytlndtwakihfaimfvg
    vnmtffpqhflglsgmprrysdypdaytmwntissmgsfisltavmlmvfiiweafaskr
    evltvdltttnlewlngcpppyhtfeeptyvnlk
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2einO (O:)
    maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe
    vetiwtilpaiililialpslrilymmdeinnpsltvktmghqwywsyeytdyedlsfds
    ymiptselkpgelrllevdnrvvlpmemtirmlvssedvlhswavpslglktdaipgrln
    qttlmssrpglyygqcseicgsnhsfmpivlelvplkyfekwsasml
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >2einP (P:)
    mthqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrd
    virestfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptg
    ihplnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqase
    yyeapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaaw
    ywhfvdvvwlflyvsiywwgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2einP (P:)
    hqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvi
    restfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgih
    plnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyy
    eapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawyw
    hfvdvvwlflyvsiywwgs
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >2einQ (Q:)
    ahgsvvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvely
    rlkfkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqt
    krmldmkvapiqgfsakwdydknewkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2einQ (Q:)
    svvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvelyrlk
    fkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqtkrm
    ldmkvapiqgfsakwdydknewkk
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >2einR (R:)
    shgshetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlnd
    fasavrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2einR (R:)
    hetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasa
    vrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2einS (S:)
    asgggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgc
    iceednstviwfwlhkgeaqrcpscgthyklvphqlah
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >2einT (T:)
    asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
    swgdgnhtffhnprvnplptgyekp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2einT (T:)
    asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
    swgdgnhtffhnprvnplptgyek
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >2einU (U:)
    aediqakiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvy
    kslcpiswvstwddrraegtfpgki
    

    Sequence, based on observed residues (ATOM records): (download)
    >2einU (U:)
    kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi
    swvstwddrraegtfpgki
    

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2einV (V:)
    stalakpqmrgllarrlrfhivgafmvslgfatfykfavaekrkkayadfyrnydsmkdf
    eemrkagifqsak
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >2einW (W:)
    fenrvaekqklfqednglpvhlkggatdnilyrvtmtlclggtlyslyclgwasfphkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2einW (W:)
    fenrvaekqklfqednglpvhlkggatdnilyrvtmtlclggtlyslyclgwasfphk
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >2einX (X:)
    ihqkrapdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewreq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2einX (X:)
    apdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewr
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >2einY (Y:)
    shyeegpgknipfsvenkwrllammtlffgsgfaapffivrhqllkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2einY (Y:)
    hyeegpgknipfsvenkwrllammtlffgsgfaapffivrhqllkk
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >2einZ (Z:)
    itakpaktptspkeqaiglsvtflsfllpagwvlyhldnykkssaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2einZ (Z:)
    itakpaktptspkeqaiglsvtflsfllpagwvlyhldnykks