PDB entry 2eim

View 2eim on RCSB PDB site
Description: Zinc ion binding structure of bovine heart cytochrome C oxidase in the fully reduced state
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2007-03-13, released 2007-05-29
The last revision prior to the SCOP 1.73 freeze date was dated 2007-05-29, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.204
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c oxidase subunit 1
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00396 (0-513)
      • modified residue (0)
    Domains in SCOP 1.73: d2eima1
  • Chain 'B':
    Compound: Cytochrome c oxidase subunit 2
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68530 (0-226)
      • modified residue (0)
    Domains in SCOP 1.73: d2eimb1, d2eimb2
  • Chain 'C':
    Compound: Cytochrome c oxidase subunit 3
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2eimc1
  • Chain 'D':
    Compound: Cytochrome c oxidase subunit 4 isoform 1
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2eimd1
  • Chain 'E':
    Compound: Cytochrome c oxidase polypeptide Va
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2eime1
  • Chain 'F':
    Compound: Cytochrome c oxidase polypeptide Vb
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2eimf1
  • Chain 'G':
    Compound: Cytochrome c oxidase polypeptide VIa-heart
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07471 (0-End)
      • modified residue (10)
    Domains in SCOP 1.73: d2eimg1
  • Chain 'H':
    Compound: Cytochrome c oxidase subunit VIb isoform 1
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2eimh1
  • Chain 'I':
    Compound: Cytochrome c oxidase polypeptide VIc
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04038 (0-72)
      • modified residue (0)
    Domains in SCOP 1.73: d2eimi1
  • Chain 'J':
    Compound: Cytochrome c oxidase polypeptide VIIa-heart
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2eimj1
  • Chain 'K':
    Compound: Cytochrome c oxidase polypeptide VIIb
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2eimk1
  • Chain 'L':
    Compound: Cytochrome c oxidase polypeptide VIIc
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2eiml1
  • Chain 'M':
    Compound: Cytochrome c oxidase polypeptide VIII-heart
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2eimm1
  • Chain 'N':
    Compound: Cytochrome c oxidase subunit 1
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00396 (0-513)
      • modified residue (0)
    Domains in SCOP 1.73: d2eimn1
  • Chain 'O':
    Compound: Cytochrome c oxidase subunit 2
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68530 (0-226)
      • modified residue (0)
    Domains in SCOP 1.73: d2eimo1, d2eimo2
  • Chain 'P':
    Compound: Cytochrome c oxidase subunit 3
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2eimp1
  • Chain 'Q':
    Compound: Cytochrome c oxidase subunit 4 isoform 1
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2eimq1
  • Chain 'R':
    Compound: Cytochrome c oxidase polypeptide Va
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2eimr1
  • Chain 'S':
    Compound: Cytochrome c oxidase polypeptide Vb
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2eims1
  • Chain 'T':
    Compound: Cytochrome c oxidase polypeptide VIa-heart
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07471 (0-End)
      • modified residue (10)
    Domains in SCOP 1.73: d2eimt1
  • Chain 'U':
    Compound: Cytochrome c oxidase subunit VIb isoform 1
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2eimu1
  • Chain 'V':
    Compound: Cytochrome c oxidase polypeptide VIc
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04038 (0-72)
      • modified residue (0)
    Domains in SCOP 1.73: d2eimv1
  • Chain 'W':
    Compound: Cytochrome c oxidase polypeptide VIIa-heart
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2eimw1
  • Chain 'X':
    Compound: Cytochrome c oxidase polypeptide VIIb
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2eimx1
  • Chain 'Y':
    Compound: Cytochrome c oxidase polypeptide VIIc
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2eimy1
  • Chain 'Z':
    Compound: Cytochrome c oxidase polypeptide VIII-heart
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2eimz1
  • Heterogens: DMU, CU, ZN, MG, NA, HEA, CUA, TGL, PGV, CHD, PSC, PEK, CDL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2eimA (A:)
    mfinrwlfstnhkdigtlyllfgawagmvgtalslliraelgqpgtllgddqiynvvvta
    hafvmiffmvmpimiggfgnwlvplmigapdmafprmnnmsfwllppsfllllassmvea
    gagtgwtvypplagnlahagasvdltifslhlagvssilgainfittiinmkppamsqyq
    tplfvwsvmitavllllslpvlaagitmlltdrnlnttffdpagggdpilyqhlfwffgh
    pevyililpgfgmishivtyysgkkepfgymgmvwammsigflgfivwahhmftvgmdvd
    trayftsatmiiaiptgvkvfswlatlhggnikwspammwalgfiflftvggltgivlan
    ssldivlhdtyyvvahfhyvlsmgavfaimggfvhwfplfsgytlndtwakihfaimfvg
    vnmtffpqhflglsgmprrysdypdaytmwntissmgsfisltavmlmvfiiweafaskr
    evltvdltttnlewlngcpppyhtfeeptyvnlk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2eimB (B:)
    maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe
    vetiwtilpaiililialpslrilymmdeinnpsltvktmghqwywsyeytdyedlsfds
    ymiptselkpgelrllevdnrvvlpmemtirmlvssedvlhswavpslglktdaipgrln
    qttlmssrpglyygqcseicgsnhsfmpivlelvplkyfekwsasml
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2eimC (C:)
    mthqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrd
    virestfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptg
    ihplnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqase
    yyeapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaaw
    ywhfvdvvwlflyvsiywwgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eimC (C:)
    hqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvi
    restfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgih
    plnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyy
    eapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawyw
    hfvdvvwlflyvsiywwgs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2eimD (D:)
    ahgsvvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvely
    rlkfkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqt
    krmldmkvapiqgfsakwdydknewkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eimD (D:)
    svvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvelyrlk
    fkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqtkrm
    ldmkvapiqgfsakwdydknewkk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2eimE (E:)
    shgshetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlnd
    fasavrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eimE (E:)
    hetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasa
    vrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2eimF (F:)
    asgggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgc
    iceednstviwfwlhkgeaqrcpscgthyklvphqlah
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2eimG (G:)
    asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
    swgdgnhtffhnprvnplptgyekp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eimG (G:)
    asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
    swgdgnhtffhnprvnplptgyek
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2eimH (H:)
    aediqakiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvy
    kslcpiswvstwddrraegtfpgki
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eimH (H:)
    kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi
    swvstwddrraegtfpgki
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2eimI (I:)
    stalakpqmrgllarrlrfhivgafmvslgfatfykfavaekrkkayadfyrnydsmkdf
    eemrkagifqsak
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2eimJ (J:)
    fenrvaekqklfqednglpvhlkggatdnilyrvtmtlclggtlyslyclgwasfphkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eimJ (J:)
    fenrvaekqklfqednglpvhlkggatdnilyrvtmtlclggtlyslyclgwasfphk
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2eimK (K:)
    ihqkrapdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewreq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eimK (K:)
    apdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewr
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2eimL (L:)
    shyeegpgknipfsvenkwrllammtlffgsgfaapffivrhqllkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eimL (L:)
    hyeegpgknipfsvenkwrllammtlffgsgfaapffivrhqllkk
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2eimM (M:)
    itakpaktptspkeqaiglsvtflsfllpagwvlyhldnykkssaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eimM (M:)
    itakpaktptspkeqaiglsvtflsfllpagwvlyhldnykks
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2eimN (N:)
    mfinrwlfstnhkdigtlyllfgawagmvgtalslliraelgqpgtllgddqiynvvvta
    hafvmiffmvmpimiggfgnwlvplmigapdmafprmnnmsfwllppsfllllassmvea
    gagtgwtvypplagnlahagasvdltifslhlagvssilgainfittiinmkppamsqyq
    tplfvwsvmitavllllslpvlaagitmlltdrnlnttffdpagggdpilyqhlfwffgh
    pevyililpgfgmishivtyysgkkepfgymgmvwammsigflgfivwahhmftvgmdvd
    trayftsatmiiaiptgvkvfswlatlhggnikwspammwalgfiflftvggltgivlan
    ssldivlhdtyyvvahfhyvlsmgavfaimggfvhwfplfsgytlndtwakihfaimfvg
    vnmtffpqhflglsgmprrysdypdaytmwntissmgsfisltavmlmvfiiweafaskr
    evltvdltttnlewlngcpppyhtfeeptyvnlk
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2eimO (O:)
    maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe
    vetiwtilpaiililialpslrilymmdeinnpsltvktmghqwywsyeytdyedlsfds
    ymiptselkpgelrllevdnrvvlpmemtirmlvssedvlhswavpslglktdaipgrln
    qttlmssrpglyygqcseicgsnhsfmpivlelvplkyfekwsasml
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >2eimP (P:)
    mthqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrd
    virestfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptg
    ihplnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqase
    yyeapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaaw
    ywhfvdvvwlflyvsiywwgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eimP (P:)
    hqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvi
    restfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgih
    plnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyy
    eapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawyw
    hfvdvvwlflyvsiywwgs
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >2eimQ (Q:)
    ahgsvvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvely
    rlkfkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqt
    krmldmkvapiqgfsakwdydknewkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eimQ (Q:)
    svvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvelyrlk
    fkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqtkrm
    ldmkvapiqgfsakwdydknewkk
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >2eimR (R:)
    shgshetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlnd
    fasavrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eimR (R:)
    hetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasa
    vrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2eimS (S:)
    asgggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgc
    iceednstviwfwlhkgeaqrcpscgthyklvphqlah
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >2eimT (T:)
    asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
    swgdgnhtffhnprvnplptgyekp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eimT (T:)
    asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
    swgdgnhtffhnprvnplptgyek
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >2eimU (U:)
    aediqakiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvy
    kslcpiswvstwddrraegtfpgki
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eimU (U:)
    kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi
    swvstwddrraegtfpgki
    

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2eimV (V:)
    stalakpqmrgllarrlrfhivgafmvslgfatfykfavaekrkkayadfyrnydsmkdf
    eemrkagifqsak
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >2eimW (W:)
    fenrvaekqklfqednglpvhlkggatdnilyrvtmtlclggtlyslyclgwasfphkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eimW (W:)
    fenrvaekqklfqednglpvhlkggatdnilyrvtmtlclggtlyslyclgwasfphk
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >2eimX (X:)
    ihqkrapdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewreq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eimX (X:)
    apdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewr
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >2eimY (Y:)
    shyeegpgknipfsvenkwrllammtlffgsgfaapffivrhqllkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eimY (Y:)
    hyeegpgknipfsvenkwrllammtlffgsgfaapffivrhqllkk
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >2eimZ (Z:)
    itakpaktptspkeqaiglsvtflsfllpagwvlyhldnykkssaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eimZ (Z:)
    itakpaktptspkeqaiglsvtflsfllpagwvlyhldnykks