PDB entry 2eil

View 2eil on RCSB PDB site
Description: Cadmium ion binding structure of bovine heart cytochrome C oxidase in the fully oxidized state
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2007-03-13, released 2007-05-29
The last revision prior to the SCOP 1.75 freeze date was dated 2007-05-29, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.199
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c oxidase subunit 1
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00396 (0-513)
      • modified residue (0)
    Domains in SCOP 1.75: d2eila1
  • Chain 'B':
    Compound: Cytochrome c oxidase subunit 2
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68530 (0-226)
      • modified residue (0)
    Domains in SCOP 1.75: d2eilb1, d2eilb2
  • Chain 'C':
    Compound: Cytochrome c oxidase subunit 3
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2eilc1
  • Chain 'D':
    Compound: Cytochrome c oxidase subunit 4 isoform 1
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2eild1
  • Chain 'E':
    Compound: Cytochrome c oxidase polypeptide Va
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2eile1
  • Chain 'F':
    Compound: Cytochrome c oxidase polypeptide Vb
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2eilf1
  • Chain 'G':
    Compound: Cytochrome c oxidase polypeptide VIa-heart
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07471 (0-End)
      • modified residue (10)
    Domains in SCOP 1.75: d2eilg1
  • Chain 'H':
    Compound: Cytochrome c oxidase subunit VIb isoform 1
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2eilh1
  • Chain 'I':
    Compound: Cytochrome c oxidase polypeptide VIc
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04038 (0-72)
      • modified residue (0)
    Domains in SCOP 1.75: d2eili1
  • Chain 'J':
    Compound: Cytochrome c oxidase polypeptide VIIa-heart
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2eilj1
  • Chain 'K':
    Compound: Cytochrome c oxidase polypeptide VIIb
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2eilk1
  • Chain 'L':
    Compound: Cytochrome c oxidase polypeptide VIIc
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2eill1
  • Chain 'M':
    Compound: Cytochrome c oxidase polypeptide VIII-heart
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2eilm1
  • Chain 'N':
    Compound: Cytochrome c oxidase subunit 1
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00396 (0-513)
      • modified residue (0)
    Domains in SCOP 1.75: d2eiln1
  • Chain 'O':
    Compound: Cytochrome c oxidase subunit 2
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68530 (0-226)
      • modified residue (0)
    Domains in SCOP 1.75: d2eilo1, d2eilo2
  • Chain 'P':
    Compound: Cytochrome c oxidase subunit 3
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2eilp1
  • Chain 'Q':
    Compound: Cytochrome c oxidase subunit 4 isoform 1
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2eilq1
  • Chain 'R':
    Compound: Cytochrome c oxidase polypeptide Va
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2eilr1
  • Chain 'S':
    Compound: Cytochrome c oxidase polypeptide Vb
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2eils1
  • Chain 'T':
    Compound: Cytochrome c oxidase polypeptide VIa-heart
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07471 (0-End)
      • modified residue (10)
    Domains in SCOP 1.75: d2eilt1
  • Chain 'U':
    Compound: Cytochrome c oxidase subunit VIb isoform 1
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2eilu1
  • Chain 'V':
    Compound: Cytochrome c oxidase polypeptide VIc
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04038 (0-72)
      • modified residue (0)
    Domains in SCOP 1.75: d2eilv1
  • Chain 'W':
    Compound: Cytochrome c oxidase polypeptide VIIa-heart
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2eilw1
  • Chain 'X':
    Compound: Cytochrome c oxidase polypeptide VIIb
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2eilx1
  • Chain 'Y':
    Compound: Cytochrome c oxidase polypeptide VIIc
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2eily1
  • Chain 'Z':
    Compound: Cytochrome c oxidase polypeptide VIII-heart
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2eilz1
  • Heterogens: DMU, CU, ZN, MG, NA, CD, HEA, CUA, TGL, PGV, CHD, PSC, PEK, CDL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2eilA (A:)
    mfinrwlfstnhkdigtlyllfgawagmvgtalslliraelgqpgtllgddqiynvvvta
    hafvmiffmvmpimiggfgnwlvplmigapdmafprmnnmsfwllppsfllllassmvea
    gagtgwtvypplagnlahagasvdltifslhlagvssilgainfittiinmkppamsqyq
    tplfvwsvmitavllllslpvlaagitmlltdrnlnttffdpagggdpilyqhlfwffgh
    pevyililpgfgmishivtyysgkkepfgymgmvwammsigflgfivwahhmftvgmdvd
    trayftsatmiiaiptgvkvfswlatlhggnikwspammwalgfiflftvggltgivlan
    ssldivlhdtyyvvahfhyvlsmgavfaimggfvhwfplfsgytlndtwakihfaimfvg
    vnmtffpqhflglsgmprrysdypdaytmwntissmgsfisltavmlmvfiiweafaskr
    evltvdltttnlewlngcpppyhtfeeptyvnlk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2eilB (B:)
    maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe
    vetiwtilpaiililialpslrilymmdeinnpsltvktmghqwywsyeytdyedlsfds
    ymiptselkpgelrllevdnrvvlpmemtirmlvssedvlhswavpslglktdaipgrln
    qttlmssrpglyygqcseicgsnhsfmpivlelvplkyfekwsasml
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2eilC (C:)
    mthqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrd
    virestfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptg
    ihplnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqase
    yyeapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaaw
    ywhfvdvvwlflyvsiywwgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eilC (C:)
    hqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvi
    restfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgih
    plnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyy
    eapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawyw
    hfvdvvwlflyvsiywwgs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2eilD (D:)
    ahgsvvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvely
    rlkfkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqt
    krmldmkvapiqgfsakwdydknewkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eilD (D:)
    svvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvelyrlk
    fkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqtkrm
    ldmkvapiqgfsakwdydknewkk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2eilE (E:)
    shgshetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlnd
    fasavrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eilE (E:)
    hetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasa
    vrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2eilF (F:)
    asgggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgc
    iceednstviwfwlhkgeaqrcpscgthyklvphqlah
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2eilG (G:)
    asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
    swgdgnhtffhnprvnplptgyekp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eilG (G:)
    asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
    swgdgnhtffhnprvnplptgyek
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2eilH (H:)
    aediqakiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvy
    kslcpiswvstwddrraegtfpgki
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eilH (H:)
    kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi
    swvstwddrraegtfpgki
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2eilI (I:)
    stalakpqmrgllarrlrfhivgafmvslgfatfykfavaekrkkayadfyrnydsmkdf
    eemrkagifqsak
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2eilJ (J:)
    fenrvaekqklfqednglpvhlkggatdnilyrvtmtlclggtlyslyclgwasfphkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eilJ (J:)
    fenrvaekqklfqednglpvhlkggatdnilyrvtmtlclggtlyslyclgwasfphk
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2eilK (K:)
    ihqkrapdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewreq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eilK (K:)
    apdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewr
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2eilL (L:)
    shyeegpgknipfsvenkwrllammtlffgsgfaapffivrhqllkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eilL (L:)
    hyeegpgknipfsvenkwrllammtlffgsgfaapffivrhqllkk
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2eilM (M:)
    itakpaktptspkeqaiglsvtflsfllpagwvlyhldnykkssaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eilM (M:)
    itakpaktptspkeqaiglsvtflsfllpagwvlyhldnykks
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2eilN (N:)
    mfinrwlfstnhkdigtlyllfgawagmvgtalslliraelgqpgtllgddqiynvvvta
    hafvmiffmvmpimiggfgnwlvplmigapdmafprmnnmsfwllppsfllllassmvea
    gagtgwtvypplagnlahagasvdltifslhlagvssilgainfittiinmkppamsqyq
    tplfvwsvmitavllllslpvlaagitmlltdrnlnttffdpagggdpilyqhlfwffgh
    pevyililpgfgmishivtyysgkkepfgymgmvwammsigflgfivwahhmftvgmdvd
    trayftsatmiiaiptgvkvfswlatlhggnikwspammwalgfiflftvggltgivlan
    ssldivlhdtyyvvahfhyvlsmgavfaimggfvhwfplfsgytlndtwakihfaimfvg
    vnmtffpqhflglsgmprrysdypdaytmwntissmgsfisltavmlmvfiiweafaskr
    evltvdltttnlewlngcpppyhtfeeptyvnlk
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2eilO (O:)
    maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe
    vetiwtilpaiililialpslrilymmdeinnpsltvktmghqwywsyeytdyedlsfds
    ymiptselkpgelrllevdnrvvlpmemtirmlvssedvlhswavpslglktdaipgrln
    qttlmssrpglyygqcseicgsnhsfmpivlelvplkyfekwsasml
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >2eilP (P:)
    mthqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrd
    virestfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptg
    ihplnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqase
    yyeapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaaw
    ywhfvdvvwlflyvsiywwgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eilP (P:)
    hqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvi
    restfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgih
    plnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyy
    eapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawyw
    hfvdvvwlflyvsiywwgs
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >2eilQ (Q:)
    ahgsvvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvely
    rlkfkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqt
    krmldmkvapiqgfsakwdydknewkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eilQ (Q:)
    svvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvelyrlk
    fkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqtkrm
    ldmkvapiqgfsakwdydknewkk
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >2eilR (R:)
    shgshetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlnd
    fasavrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eilR (R:)
    hetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasa
    vrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2eilS (S:)
    asgggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgc
    iceednstviwfwlhkgeaqrcpscgthyklvphqlah
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >2eilT (T:)
    asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
    swgdgnhtffhnprvnplptgyekp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eilT (T:)
    asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
    swgdgnhtffhnprvnplptgyek
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >2eilU (U:)
    aediqakiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvy
    kslcpiswvstwddrraegtfpgki
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eilU (U:)
    kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi
    swvstwddrraegtfpgki
    

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2eilV (V:)
    stalakpqmrgllarrlrfhivgafmvslgfatfykfavaekrkkayadfyrnydsmkdf
    eemrkagifqsak
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >2eilW (W:)
    fenrvaekqklfqednglpvhlkggatdnilyrvtmtlclggtlyslyclgwasfphkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eilW (W:)
    fenrvaekqklfqednglpvhlkggatdnilyrvtmtlclggtlyslyclgwasfphk
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >2eilX (X:)
    ihqkrapdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewreq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eilX (X:)
    apdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewr
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >2eilY (Y:)
    shyeegpgknipfsvenkwrllammtlffgsgfaapffivrhqllkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eilY (Y:)
    hyeegpgknipfsvenkwrllammtlffgsgfaapffivrhqllkk
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >2eilZ (Z:)
    itakpaktptspkeqaiglsvtflsfllpagwvlyhldnykkssaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eilZ (Z:)
    itakpaktptspkeqaiglsvtflsfllpagwvlyhldnykks