PDB entry 2eid

View 2eid on RCSB PDB site
Description: Galactose Oxidase W290G mutant
Class: oxidoreductase
Keywords: Galactose Oxidase W290G mutant, OXIDOREDUCTASE
Deposited on 2007-03-12, released 2007-04-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.192
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Galactose oxidase
    Species: GIBBERELLA ZEAE [TaxId:5518]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q01745 (0-638)
      • engineered (289)
    Domains in SCOPe 2.07: d2eida1, d2eida2, d2eida3
  • Heterogens: CU, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2eidA (A:)
    asapigsaisrnnwavtcdsaqsgnecnkaidgnkdtfwhtfygangdpkpphtytidmk
    ttqnvnglsmlprqdgnqngwigrhevylssdgtnwgspvasgswfadsttkysnfetrp
    aryvrlvaiteangqpwtsiaeinvfqassytapqpglgrwgptidlpivpaaaaiepts
    grvlmwssyrndafggspggitltsswdpstgivsdrtvtvtkhdmfcpgismdgngqiv
    vtggndakktslydsssdswipgpdmqvargyqssatmsdgrvftiggsgsggvfeknge
    vyspssktwtslpnakvnpmltadkqglyrsdnhawlfgwkkgsvfqagpstamnwyyts
    gsgdvksagkrqsnrgvapdamcgnavmydavkgkiltfggspdyqdsdattnahiitlg
    epgtspntvfasnglyfartfhtsvvlpdgstfitggqrrgipfedstpvftpeiyvpeq
    dtfykqnpnsivrvyhsislllpdgrvfngggglcgdcttnhfdaqiftpnylynsngnl
    atrpkitrtstqsvkvggritistdssiskaslirygtathtvntdqrripltltnnggn
    sysfqvpsdsgvalpgywmlfvmnsagvpsvastirvtq