PDB entry 2ei2

View 2ei2 on RCSB PDB site
Description: Crystal Structure Analysis of the 1,2-dihydroxynaphthalene dioxygenase from Pseudomonas sp. stain C18
Class: Oxidoreductase
Keywords: extradiol dioxygenase, Oxidoreductase
Deposited on 2007-03-10, released 2008-02-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: 0.163
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1,2-dihydroxynaphthalene dioxygenase
    Species: Pseudomonas sp. [TaxId:69011]
    Gene: doxG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A108 (Start-301)
      • conflict (3)
    Domains in SCOPe 2.07: d2ei2a1, d2ei2a2
  • Heterogens: MG, FE2, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ei2A (A:)
    msknaavielgymgisvkdpdawksfatdmlglqvldegekdrfylrmdywhhrivvhhn
    gqddleylgwrvagkpefealgqklidagykiricdkveaqermvlglmktedpggnpte
    ifwgpridmsnpfhpgrplhgkfvtgdqglghcivrqtdvaeahkfysllgfrgdveyri
    plpngmtaelsfmhcnardhsiafgampaakrlnhlmleythmedlgythqqfvkneidi
    alqlgihandkaltfygatpsgwliepgwrgataideaeyyvgdifghgveatgygldvk
    ls
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ei2A (A:)
    naavielgymgisvkdpdawksfatdmlglqvldegekdrfylrmdywhhrivvhhngqd
    dleylgwrvagkpefealgqklidagykiricdkveaqermvlglmktedpggnpteifw
    gpridmsnpfhpgrplhgkfvtgdqglghcivrqtdvaeahkfysllgfrgdveyriplp
    ngmtaelsfmhcnardhsiafgampaakrlnhlmleythmedlgythqqfvkneidialq
    lgihandkaltfygatpsgwliepgwrgataideaeyyvgdifghgveatgygldvkls