PDB entry 2ei0

View 2ei0 on RCSB PDB site
Description: Anaerobic Crystal Structure Analysis of 1,2-dihydroxynaphthalene dioxygenase from Pseudomonas sp. strain C18 complexed with 3,4-dihydroxybiphenyl
Class: Oxidoreductase
Keywords: extradiol dioxygenase, protein substrate complex, Oxidoreductase
Deposited on 2007-03-10, released 2008-02-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.161
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1,2-dihydroxynaphthalene dioxygenase
    Species: Pseudomonas sp. [TaxId:69011]
    Gene: doxG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ei0a1, d2ei0a2
  • Heterogens: FE2, MG, BP7, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ei0A (A:)
    mskqaavielgymgisvkdpdawksfatdmlglqvldegekdrfylrmdywhhrivvhhn
    gqddleylgwrvagkpefealgqklidagykiricdkveaqermvlglmktedpggnpte
    ifwgpridmsnpfhpgrplhgkfvtgdqglghcivrqtdvaeahkfysllgfrgdveyri
    plpngmtaelsfmhcnardhsiafgampaakrlnhlmleythmedlgythqqfvkneidi
    alqlgihandkaltfygatpsgwliepgwrgataideaeyyvgdifghgveatgygldvk
    ls
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ei0A (A:)
    aavielgymgisvkdpdawksfatdmlglqvldegekdrfylrmdywhhrivvhhngqdd
    leylgwrvagkpefealgqklidagykiricdkveaqermvlglmktedpggnpteifwg
    pridmsnpfhpgrplhgkfvtgdqglghcivrqtdvaeahkfysllgfrgdveyriptae
    lsfmhcnardhsiafgampaakrlnhlmleythmedlgythqqfvkneidialqlgihan
    dkaltfygatpsgwliepgwrgataideaeyyvgdifghgveatgy