PDB entry 2ehg

View 2ehg on RCSB PDB site
Description: Crystal structure of hyperthermophilic archaeal RNase HI
Class: hydrolase
Keywords: RNase HI, hyperthermophilic archaeon, Sulfolobus tokodaii, double-stranded RNA-dependent RNase, HYDROLASE
Deposited on 2007-03-06, released 2007-09-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.194
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease hi
    Species: Sulfolobus tokodaii [TaxId:273063]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ehga_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ehgA (A:)
    miigyfdglcepknpggiatfgfviyldnrkiegyglaekpfsinstnnvaeysgliclm
    etmlrlgisspiikgdsqlvikqmngeykvkakriiplyekaielkkklnatliwvpree
    nkeadrlsrvayelvrrgklrdigciilt