PDB entry 2ehb

View 2ehb on RCSB PDB site
Description: The structure of the C-terminal domain of the protein kinase AtSOS2 bound to the calcium sensor AtSOS3
Class: SIGNALLING PROTEIN/Transferase
Keywords: protein complex, Ca(II) ions bound to SOS3 (EF-hands 1 and 4), SOS2 FISL motif, SOS2 phosphatase binding domain (PPI), SIGNALLING PROTEIN-Transferase COMPLEX
Deposited on 2007-03-06, released 2007-09-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.217
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Calcineurin B-like protein 4
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: SOS3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ehba_
  • Chain 'D':
    Compound: CBL-interacting serine/threonine-protein kinase 24
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: SOS2
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ehbA (A:)
    mgcsvskkkkknamrppgyedpellasvtpftveevealyelfkklsssiiddglihkee
    fqlalfrnrnrrnlfadrifdvfdvkrngviefgefvrslgvfhpsapvhekvkfafkly
    dlrqtgfiereelkemvvallheselvlsedmievmvdkafvqadrkndgkididewkdf
    vslnpsliknmtlpylkdinrtfpsfv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ehbA (A:)
    dpellasvtpftveevealyelfkklsssiiddglihkeefqlalfrnrnrrnlfadrif
    dvfdvkrngviefgefvrslgvfhpsapvhekvkfafklydlrqtgfiereelkemvval
    lheselvlsedmievmvdkafvqadrkndgkididewkdfvslnpsliknmtlpylkdin
    rt
    

  • Chain 'D':
    No sequence available.