PDB entry 2eh7

View 2eh7 on RCSB PDB site
Description: Crystal structure of humanized KR127 FAB
Class: immune system
Keywords: hepatitis b virus, humanized antibody, monoclonal antibody, neutralization, pres1, immune system
Deposited on 2007-03-05, released 2008-01-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: humanized kr127 fab, heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene: HUMANIZED KR127
    Database cross-references and differences (RAF-indexed):
    • PDB 2EH7 (0-217)
  • Chain 'L':
    Compound: humanized kr127 fab, light chain
    Species: Mus musculus [TaxId:10090]
    Gene: HUMANIZED KR127
    Database cross-references and differences (RAF-indexed):
    • PDB 2EH7 (0-218)
    Domains in SCOPe 2.07: d2eh7l1, d2eh7l2

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2eh7L (L:)
diqmtqtplslsvtpgqpasisckssqsllysngktylnwllqkpgqspkrliylvskld
sgvpdrfsgsgsgtdftlkisrveaedvgvyycvqgthfpqtfgggtkveikrtvaapsv
fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
sstltlskadyekhkvyacevthqglsspvtksfnrgec