PDB entry 2egc

View 2egc on RCSB PDB site
Description: Solution structure of the fifth SH3 domain from human KIAA0418 protein
Class: signaling protein
Keywords: SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2007-02-28, released 2007-08-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SH3 and PX domain-containing protein 2A
    Species: Homo sapiens [TaxId:9606]
    Gene: SH3PXD2A, FISH, KIAA0418, SH3MD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5TCZ1 (7-68)
      • expression tag (0-6)
      • expression tag (69-74)
    Domains in SCOPe 2.06: d2egca1, d2egca2, d2egca3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2egcA (A:)
gssgssgnlkdvyvsiadyegdeetagfqegvsmevlernpngwwycqildgvkpfkgwv
psnylekknsgpssg