PDB entry 2efy

View 2efy on RCSB PDB site
Description: Crystal Structure of T.th. HB8 O-acetylserine sulfhydrylase Complexed with 4-Acetylbutyric acid
Class: transferase
Keywords: PLP-dependent enzyme, TRANSFERASE
Deposited on 2007-02-26, released 2008-02-26
The last revision prior to the SCOP 1.75 freeze date was dated 2008-02-26, with a file datestamp of 2008-02-22.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.193
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: O-acetylserine (Thiol)-lyase
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2efya1
  • Chain 'B':
    Compound: O-acetylserine (Thiol)-lyase
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2efyb1
  • Heterogens: PLP, 4AT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2efyA (A:)
    mrvegaigktpvvrlakvvepdmaevwvkleglnpggsikdrpawymikdaeergilrpg
    sgqviveptsgntgiglamiaasrgyrliltmpaqmseerkrvlkafgaelvltdperrm
    laareealrlkeelgafmpdqfknpanvrahyettgpelyealegridafvygsgtggti
    tgvgrylkeriphvkviaveparsnvlsggkmgqhgfqgmgpgfipenldlslldgviqv
    weedafplarrlareeglflgmssggivwaalqvarelgpgkrvacispdggwkylstpl
    yaep
    

    Sequence, based on observed residues (ATOM records): (download)
    >2efyA (A:)
    mrvegaigktpvvrlakvvepdmaevwvkleglnpggsikdrpawymikdaeergilrpg
    sgqviveptsgntgiglamiaasrgyrliltmpaqmseerkrvlkafgaelvltdperrm
    laareealrlkeelgafmpdqfknpanvrahyettgpelyealegridafvygsgtggti
    tgvgrylkeriphvkviaveparsnvlsggkmgqhgfqgmgpgfipenldlslldgviqv
    weedafplarrlareeglflgmssggivwaalqvarelgpgkrvacispdggwkylstpl
    ya
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2efyB (B:)
    mrvegaigktpvvrlakvvepdmaevwvkleglnpggsikdrpawymikdaeergilrpg
    sgqviveptsgntgiglamiaasrgyrliltmpaqmseerkrvlkafgaelvltdperrm
    laareealrlkeelgafmpdqfknpanvrahyettgpelyealegridafvygsgtggti
    tgvgrylkeriphvkviaveparsnvlsggkmgqhgfqgmgpgfipenldlslldgviqv
    weedafplarrlareeglflgmssggivwaalqvarelgpgkrvacispdggwkylstpl
    yaep
    

    Sequence, based on observed residues (ATOM records): (download)
    >2efyB (B:)
    mrvegaigktpvvrlakvvepdmaevwvkleglnpggsikdrpawymikdaeergilrpg
    sgqviveptsgntgiglamiaasrgyrliltmpaqmseerkrvlkafgaelvltdperrm
    laareealrlkeelgafmpdqfknpanvrahyettgpelyealegridafvygsgtggti
    tgvgrylkeriphvkviaveparsnvlsggkmgqhgfqgmgpgfipenldlslldgviqv
    weedafplarrlareeglflgmssggivwaalqvarelgpgkrvacispdggwkylstpl
    ya