PDB entry 2efx

View 2efx on RCSB PDB site
Description: The crystal structure of D-amino acid amidase from Ochrobactrum anthropi SV3 complexed with L-phenylalanine amide
Class: hydrolase
Keywords: penicillin recognizing proteins, D-stereospecific amidase, L-phenylalanine amide, hydrolase
Deposited on 2007-02-26, released 2007-03-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2008-03-04, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.19
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: D-amino acid amidase
    Species: Ochrobactrum anthropi [TaxId:529]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2efxa_
  • Chain 'B':
    Compound: D-amino acid amidase
    Species: Ochrobactrum anthropi [TaxId:529]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2efxb_
  • Chain 'C':
    Compound: D-amino acid amidase
    Species: Ochrobactrum anthropi [TaxId:529]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2efxc_
  • Chain 'D':
    Compound: D-amino acid amidase
    Species: Ochrobactrum anthropi [TaxId:529]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2efxd_
  • Chain 'E':
    Compound: D-amino acid amidase
    Species: Ochrobactrum anthropi [TaxId:529]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2efxe_
  • Chain 'F':
    Compound: D-amino acid amidase
    Species: Ochrobactrum anthropi [TaxId:529]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2efxf_
  • Heterogens: BA, NFA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2efxA (A:)
    msdlnnaiqgilddhvargvvgvslalclpgeetslyqsgyadkfnkmpmtgdhlfrias
    ctksfiatglhllvqdgtvdldepitrwfpdlpkaaqmpvrillnhrsglpdfetsmpmi
    sdkswtaqeivdfsfrhgvqkepwhgmeysntgyvlagmiiahetgkpysdhlrsrifap
    lgmkdtwvgthetfpiereargymhaaaddenpqwdvsgagdpvdgvwdstewfplsgan
    aagdmvstprdivkflnalfdgrildqkrlwemkdnikpaffpgsntvanghglllmryg
    sselkghlgqipghtsimgrdeetgaalmliqnsgagdfesfylkgvnepvdrvleaikn
    srs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2efxA (A:)
    sdlnnaiqgilddhvargvvgvslalclpgeetslyqsgyadkfnkmpmtgdhlfriasc
    tksfiatglhllvqdgtvdldepitrwfpdlpkaaqmpvrillnhrsglpdfetsmpmis
    dkswtaqeivdfsfrhgvqkepwhgmeysntgyvlagmiiahetgkpysdhlrsrifapl
    gmkdtwvgthetfpiereargymhaaaddenpqwdvsgagdpvdgvwdstewfplsgana
    agdmvstprdivkflnalfdgrildqkrlwemkdnikpaffpgsntvanghglllmrygs
    selkghlgqipghtsimgrdeetgaalmliqnsgagdfesfylkgvnepvdrvleaikns
    rs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2efxB (B:)
    msdlnnaiqgilddhvargvvgvslalclpgeetslyqsgyadkfnkmpmtgdhlfrias
    ctksfiatglhllvqdgtvdldepitrwfpdlpkaaqmpvrillnhrsglpdfetsmpmi
    sdkswtaqeivdfsfrhgvqkepwhgmeysntgyvlagmiiahetgkpysdhlrsrifap
    lgmkdtwvgthetfpiereargymhaaaddenpqwdvsgagdpvdgvwdstewfplsgan
    aagdmvstprdivkflnalfdgrildqkrlwemkdnikpaffpgsntvanghglllmryg
    sselkghlgqipghtsimgrdeetgaalmliqnsgagdfesfylkgvnepvdrvleaikn
    srs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2efxB (B:)
    sdlnnaiqgilddhvargvvgvslalclpgeetslyqsgyadkfnkmpmtgdhlfriasc
    tksfiatglhllvqdgtvdldepitrwfpdlpkaaqmpvrillnhrsglpdfetsmpmis
    dkswtaqeivdfsfrhgvqkepwhgmeysntgyvlagmiiahetgkpysdhlrsrifapl
    gmkdtwvgthetfpiereargymhaaaddenpqwdvsgagdpvdgvwdstewfplsgana
    agdmvstprdivkflnalfdgrildqkrlwemkdnikpaffpgsntvanghglllmrygs
    selkghlgqipghtsimgrdeetgaalmliqnsgagdfesfylkgvnepvdrvleaikns
    rs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2efxC (C:)
    msdlnnaiqgilddhvargvvgvslalclpgeetslyqsgyadkfnkmpmtgdhlfrias
    ctksfiatglhllvqdgtvdldepitrwfpdlpkaaqmpvrillnhrsglpdfetsmpmi
    sdkswtaqeivdfsfrhgvqkepwhgmeysntgyvlagmiiahetgkpysdhlrsrifap
    lgmkdtwvgthetfpiereargymhaaaddenpqwdvsgagdpvdgvwdstewfplsgan
    aagdmvstprdivkflnalfdgrildqkrlwemkdnikpaffpgsntvanghglllmryg
    sselkghlgqipghtsimgrdeetgaalmliqnsgagdfesfylkgvnepvdrvleaikn
    srs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2efxC (C:)
    dlnnaiqgilddhvargvvgvslalclpgeetslyqsgyadkfnkmpmtgdhlfriasct
    ksfiatglhllvqdgtvdldepitrwfpdlpkaaqmpvrillnhrsglpdfetsmpmisd
    kswtaqeivdfsfrhgvqkepwhgmeysntgyvlagmiiahetgkpysdhlrsrifaplg
    mkdtwvgthetfpiereargymhadenpqwdvsgagdpvdgvwdstewfplsganaagdm
    vstprdivkflnalfdgrildqkrlwemkdnikpaffpgsntvanghglllmrygsselk
    ghlgqipghtsimgrdeetgaalmliqnsgagdfesfylkgvnepvdrvleaiknsrs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2efxD (D:)
    msdlnnaiqgilddhvargvvgvslalclpgeetslyqsgyadkfnkmpmtgdhlfrias
    ctksfiatglhllvqdgtvdldepitrwfpdlpkaaqmpvrillnhrsglpdfetsmpmi
    sdkswtaqeivdfsfrhgvqkepwhgmeysntgyvlagmiiahetgkpysdhlrsrifap
    lgmkdtwvgthetfpiereargymhaaaddenpqwdvsgagdpvdgvwdstewfplsgan
    aagdmvstprdivkflnalfdgrildqkrlwemkdnikpaffpgsntvanghglllmryg
    sselkghlgqipghtsimgrdeetgaalmliqnsgagdfesfylkgvnepvdrvleaikn
    srs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2efxD (D:)
    sdlnnaiqgilddhvargvvgvslalclpgeetslyqsgyadkfnkmpmtgdhlfriasc
    tksfiatglhllvqdgtvdldepitrwfpdlpkaaqmpvrillnhrsglpdfetsmpmis
    dkswtaqeivdfsfrhgvqkepwhgmeysntgyvlagmiiahetgkpysdhlrsrifapl
    gmkdtwvgthetfpiereargymhaaagdpvdgvwdstewfplsganaagdmvstprdiv
    kflnalfdgrildqkrlwemkdnikpaffpgsntvanghglllmrygsselkghlgqipg
    htsimgrdeetgaalmliqnsgagdfesfylkgvnepvdrvleaiknsrs
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2efxE (E:)
    msdlnnaiqgilddhvargvvgvslalclpgeetslyqsgyadkfnkmpmtgdhlfrias
    ctksfiatglhllvqdgtvdldepitrwfpdlpkaaqmpvrillnhrsglpdfetsmpmi
    sdkswtaqeivdfsfrhgvqkepwhgmeysntgyvlagmiiahetgkpysdhlrsrifap
    lgmkdtwvgthetfpiereargymhaaaddenpqwdvsgagdpvdgvwdstewfplsgan
    aagdmvstprdivkflnalfdgrildqkrlwemkdnikpaffpgsntvanghglllmryg
    sselkghlgqipghtsimgrdeetgaalmliqnsgagdfesfylkgvnepvdrvleaikn
    srs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2efxE (E:)
    sdlnnaiqgilddhvargvvgvslalclpgeetslyqsgyadknkmpmtgdhlfriasct
    ksfiatglhllvqdgtvdldepitrwfpdlpkaaqmpvrillnhrsglpdfetsmpmisd
    kswtaqeivdfsfrhgvqkepwhgmeysntgyvlagmiiahetgkpysdhlrsrifaplg
    mkdtwvgthetfpiereargymhapvdgvwdstewfplsganaagdmvstprdivkflna
    lfdgrildqkrlwemkdnikpaffpgsntvanghglllmrygsselkghlgqipghtsim
    grdeetgaalmliqnsgagdfesfylkgvnepvdrvleaiknsrs
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2efxF (F:)
    msdlnnaiqgilddhvargvvgvslalclpgeetslyqsgyadkfnkmpmtgdhlfrias
    ctksfiatglhllvqdgtvdldepitrwfpdlpkaaqmpvrillnhrsglpdfetsmpmi
    sdkswtaqeivdfsfrhgvqkepwhgmeysntgyvlagmiiahetgkpysdhlrsrifap
    lgmkdtwvgthetfpiereargymhaaaddenpqwdvsgagdpvdgvwdstewfplsgan
    aagdmvstprdivkflnalfdgrildqkrlwemkdnikpaffpgsntvanghglllmryg
    sselkghlgqipghtsimgrdeetgaalmliqnsgagdfesfylkgvnepvdrvleaikn
    srs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2efxF (F:)
    qgildvagsalclpgetsgyakgdhlfriasctksfiatglhllvqdgtvdldepitrwf
    pdlpkaaqmpvrillnhrsglpdfetsmpmisdkswtaqeivdfsfrhgvqkepwhgmey
    sntgyvlagmiiahetgkpysdhlrsriplgdvgthetfpiagmhawdstwfplsganaa
    gdmstprdivkflnalfdgrildqkrlwemkdnikpaffpgsntvanghglllmrygsse
    lkghlgqipghtsimgrdeetgaalmliqsgagdfesfylkgvnepvdrveaikns