PDB entry 2efu

View 2efu on RCSB PDB site
Description: The crystal structure of D-amino acid amidase from Ochrobactrum anthropi SV3 complexed with L-phenylalanine
Class: hydrolase
Keywords: penicillin recognizing proteins, D-stereospecific, amidase, L-phenylalanine
Deposited on 2007-02-26, released 2007-03-06
The last revision prior to the SCOP 1.73 freeze date was dated 2007-03-06, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.174
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: D-amino acid amidase
    Species: Ochrobactrum anthropi
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2efua1
  • Chain 'B':
    Compound: D-amino acid amidase
    Species: Ochrobactrum anthropi
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2efub1
  • Chain 'C':
    Compound: D-amino acid amidase
    Species: Ochrobactrum anthropi
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2efuc1
  • Chain 'D':
    Compound: D-amino acid amidase
    Species: Ochrobactrum anthropi
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2efud1
  • Chain 'E':
    Compound: D-amino acid amidase
    Species: Ochrobactrum anthropi
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2efue1
  • Chain 'F':
    Compound: D-amino acid amidase
    Species: Ochrobactrum anthropi
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2efuf1
  • Heterogens: BA, PHE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2efuA (A:)
    msdlnnaiqgilddhvargvvgvslalclpgeetslyqsgyadkfnkmpmtgdhlfrias
    ctksfiatglhllvqdgtvdldepitrwfpdlpkaaqmpvrillnhrsglpdfetsmpmi
    sdkswtaqeivdfsfrhgvqkepwhgmeysntgyvlagmiiahetgkpysdhlrsrifap
    lgmkdtwvgthetfpiereargymhaaaddenpqwdvsgagdpvdgvwdstewfplsgan
    aagdmvstprdivkflnalfdgrildqkrlwemkdnikpaffpgsntvanghglllmryg
    sselkghlgqipghtsimgrdeetgaalmliqnsgagdfesfylkgvnepvdrvleaikn
    srs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2efuA (A:)
    sdlnnaiqgilddhvargvvgvslalclpgeetslyqsgyadkfnkmpmtgdhlfriasc
    tksfiatglhllvqdgtvdldepitrwfpdlpkaaqmpvrillnhrsglpdfetsmpmis
    dkswtaqeivdfsfrhgvqkepwhgmeysntgyvlagmiiahetgkpysdhlrsrifapl
    gmkdtwvgthetfpiereargymhaaaddenpqwdvsgagdpvdgvwdstewfplsgana
    agdmvstprdivkflnalfdgrildqkrlwemkdnikpaffpgsntvanghglllmrygs
    selkghlgqipghtsimgrdeetgaalmliqnsgagdfesfylkgvnepvdrvleaikns
    rs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2efuB (B:)
    msdlnnaiqgilddhvargvvgvslalclpgeetslyqsgyadkfnkmpmtgdhlfrias
    ctksfiatglhllvqdgtvdldepitrwfpdlpkaaqmpvrillnhrsglpdfetsmpmi
    sdkswtaqeivdfsfrhgvqkepwhgmeysntgyvlagmiiahetgkpysdhlrsrifap
    lgmkdtwvgthetfpiereargymhaaaddenpqwdvsgagdpvdgvwdstewfplsgan
    aagdmvstprdivkflnalfdgrildqkrlwemkdnikpaffpgsntvanghglllmryg
    sselkghlgqipghtsimgrdeetgaalmliqnsgagdfesfylkgvnepvdrvleaikn
    srs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2efuB (B:)
    lnnaiqgilddhvargvvgvslalclpgeetslyqsgyadkfnkmpmtgdhlfriasctk
    sfiatglhllvqdgtvdldepitrwfpdlpkaaqmpvrillnhrsglpdfetsmpmisdk
    swtaqeivdfsfrhgvqkepwhgmeysntgyvlagmiiahetgkpysdhlrsrifaplgm
    kdtwvgthetfpiereargymhaaddenpqwdvsgagdpvdgvwdstewfplsganaagd
    mvstprdivkflnalfdgrildqkrlwemkdnikpaffpgsntvanghglllmrygssel
    kghlgqipghtsimgrdeetgaalmliqnsgagdfesfylkgvnepvdrvleaiknsrs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2efuC (C:)
    msdlnnaiqgilddhvargvvgvslalclpgeetslyqsgyadkfnkmpmtgdhlfrias
    ctksfiatglhllvqdgtvdldepitrwfpdlpkaaqmpvrillnhrsglpdfetsmpmi
    sdkswtaqeivdfsfrhgvqkepwhgmeysntgyvlagmiiahetgkpysdhlrsrifap
    lgmkdtwvgthetfpiereargymhaaaddenpqwdvsgagdpvdgvwdstewfplsgan
    aagdmvstprdivkflnalfdgrildqkrlwemkdnikpaffpgsntvanghglllmryg
    sselkghlgqipghtsimgrdeetgaalmliqnsgagdfesfylkgvnepvdrvleaikn
    srs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2efuC (C:)
    dlnnaiqgilddhvargvvgvslalclpgeetslyqsgyadkfnkmpmtgdhlfriasct
    ksfiatglhllvqdgtvdldepitrwfpdlpkaaqmpvrillnhrsglpdfetsmpmisd
    kswtaqeivdfsfrhgvqkepwhgmeysntgyvlagmiiahetgkpysdhlrsrifaplg
    mkdtwvgthetfpiereargymhaaaddenpqwdvsgagdpvdgvwdstewfplsganaa
    gdmvstprdivkflnalfdgrildqkrlwemkdnikpaffpgsntvanghglllmrygss
    elkghlgqipghtsimgrdeetgaalmliqnsgagdfesfylkgvnepvdrvleaiknsr
    s
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2efuD (D:)
    msdlnnaiqgilddhvargvvgvslalclpgeetslyqsgyadkfnkmpmtgdhlfrias
    ctksfiatglhllvqdgtvdldepitrwfpdlpkaaqmpvrillnhrsglpdfetsmpmi
    sdkswtaqeivdfsfrhgvqkepwhgmeysntgyvlagmiiahetgkpysdhlrsrifap
    lgmkdtwvgthetfpiereargymhaaaddenpqwdvsgagdpvdgvwdstewfplsgan
    aagdmvstprdivkflnalfdgrildqkrlwemkdnikpaffpgsntvanghglllmryg
    sselkghlgqipghtsimgrdeetgaalmliqnsgagdfesfylkgvnepvdrvleaikn
    srs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2efuD (D:)
    sdlnnaiqgilddhvargvvgvslalclpgeetslyqsgyadkfnkmpmtgdhlfriasc
    tksfiatglhllvqdgtvdldepitrwfpdlpkaaqmpvrillnhrsglpdfetsmpmis
    dkswtaqeivdfsfrhgvqkepwhgmeysntgyvlagmiiahetgkpysdhlrsrifapl
    gmkdtwvgthetfpiereargymhaaagdpvdgvwdstewfplsganaagdmvstprdiv
    kflnalfdgrildqkrlwemkdnikpaffpgsntvanghglllmrygsselkghlgqipg
    htsimgrdeetgaalmliqnsgagdfesfylkgvnepvdrvleaiknsrs
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2efuE (E:)
    msdlnnaiqgilddhvargvvgvslalclpgeetslyqsgyadkfnkmpmtgdhlfrias
    ctksfiatglhllvqdgtvdldepitrwfpdlpkaaqmpvrillnhrsglpdfetsmpmi
    sdkswtaqeivdfsfrhgvqkepwhgmeysntgyvlagmiiahetgkpysdhlrsrifap
    lgmkdtwvgthetfpiereargymhaaaddenpqwdvsgagdpvdgvwdstewfplsgan
    aagdmvstprdivkflnalfdgrildqkrlwemkdnikpaffpgsntvanghglllmryg
    sselkghlgqipghtsimgrdeetgaalmliqnsgagdfesfylkgvnepvdrvleaikn
    srs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2efuE (E:)
    sdlnnaiqgilddhvargvvgvslalclpgeetslyqsgyadkfnmpmtgdhlfriasct
    ksfiatglhllvqdgtvdldepitrwfpdlpkaaqmpvrillnhrsglpdfetsmpmisd
    kswtaqeivdfsfrhgvqkepwhgmeysntgyvlagmiiahetgkpysdhlrsrifaplg
    mkdtwvgthetfpiereargymhagvwdstewfplsganaagdmvstprdivkflnalfd
    grildqkrlwemkdnikpaffpgsntvanghglllmrygsselkghlgqipghtsimgrd
    eetgaalmliqnsgagdfesfylkgvnepvdrvleaiknsrs
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2efuF (F:)
    msdlnnaiqgilddhvargvvgvslalclpgeetslyqsgyadkfnkmpmtgdhlfrias
    ctksfiatglhllvqdgtvdldepitrwfpdlpkaaqmpvrillnhrsglpdfetsmpmi
    sdkswtaqeivdfsfrhgvqkepwhgmeysntgyvlagmiiahetgkpysdhlrsrifap
    lgmkdtwvgthetfpiereargymhaaaddenpqwdvsgagdpvdgvwdstewfplsgan
    aagdmvstprdivkflnalfdgrildqkrlwemkdnikpaffpgsntvanghglllmryg
    sselkghlgqipghtsimgrdeetgaalmliqnsgagdfesfylkgvnepvdrvleaikn
    srs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2efuF (F:)
    lnnaiqgilddhvargvvgvslalclpgeetslyqsgyadkmpmtgdhlfriasctksfi
    atglhllvqdgtvdldepitrwfpdlpkaaqmpvrillnhrsglpdfetsmpmisdkswt
    aqeivdfsfrhgvqkepwhgmeysntgyvlagmiiahetgkpysdhlrsrifaplgmkdt
    wvgthetfpiereargymhwdstewfplsganaagdmvstprdivkflnalfdgrildqk
    rlwemkdnikpaffpgsntvanghglllmrygsselkghlgqipghtsimgrdeetgaal
    mliqnsgagdfesfylkgvnepvdrvleai