PDB entry 2efh

View 2efh on RCSB PDB site
Description: Ara7-GDP/AtVps9a(D185N)
Class: transport protein
Keywords: GEF, GTPase, Vps9, Rab5, nucleotide, TRANSPORT PROTEIN
Deposited on 2007-02-22, released 2008-02-26
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-12-21, with a file datestamp of 2011-12-16.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.216
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Similarity to vacuolar protein sorting-associated protein VPS9
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9LT31
      • engineered (186)
  • Chain 'B':
    Compound: Small GTP-binding protein-like
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2efhb_
  • Chain 'C':
    Compound: Similarity to vacuolar protein sorting-associated protein VPS9
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9LT31
      • engineered (186)
  • Chain 'D':
    Compound: Small GTP-binding protein-like
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2efhd_
  • Heterogens: GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2efhB (B:)
    gsmaaagnksinaklvllgdvgagksslvlrfvkdqfvefqestigaaffsqtlavndat
    vkfeiwdtagqeryhslapmyyrgaaaaiivfdvtnqasferakkwvqelqaqgnpnmvm
    alagnksdlldarkvtaedaqtyaqenglffmetsaktatnvkeifyeiarrlprvqpte
    n
    

    Sequence, based on observed residues (ATOM records): (download)
    >2efhB (B:)
    sinaklvllgdvgagksslvlrfvaaffsqtlavndatvkfeiwdtagqeryhslapmyy
    rgaaaaiivfdvtnqasferakkwvqelqaqgnpnmvmalagnksdlldarkvtaedaqt
    yaqenglffmetsaktatnvkeifyeiarrlp
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2efhD (D:)
    gsmaaagnksinaklvllgdvgagksslvlrfvkdqfvefqestigaaffsqtlavndat
    vkfeiwdtagqeryhslapmyyrgaaaaiivfdvtnqasferakkwvqelqaqgnpnmvm
    alagnksdlldarkvtaedaqtyaqenglffmetsaktatnvkeifyeiarrlprvqpte
    n
    

    Sequence, based on observed residues (ATOM records): (download)
    >2efhD (D:)
    sinaklvllgdvgagksslvlrfvaaffsqtlavndatvkfeiwdtagqeryhslapmyy
    rgaaaaiivfdvtnqasferakkwvqelqaqgnpnmvmalagnksdlldarkvtaedaqt
    yaqenglffmetsaktatnvkeifyeiarrlp