PDB entry 2efg

View 2efg on RCSB PDB site
Description: translational elongation factor g complexed with gdp
Deposited on 1998-09-23, released 1999-09-30
The last revision prior to the SCOP 1.55 freeze date was dated 1999-12-29, with a file datestamp of 1999-12-28.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.221
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2efgA (A:)
    ydlkrlrnigiaahidagktttterilyytgrihkigevhegaatmdfmeqerergitit
    aavttcfwkdhriniidtpghvdftieversmrvldgaivvfdssqgvepqsetvwrqae
    kykvpriafankmdktgadlwlvirtmqerlgarpvvmqlpigredtfsgiidvlrmkay
    tygndlgtdireipipeeyldnareyheklvevaadfdenimlkylegeepteeelvaai
    rkgtidlkitpvflgsalknkgvqllldavvdylpspldippikgttpegevveihpdpn
    gplaalafkimadpyvgrltfirvysgtltsgsyvynttkgrkervarllrmhanhreev
    eelkagdlgavvglketitgdtlvgedaprvilesievpepvidvaiepktkadqeklsq
    alarlaeedptfrvsthpetgqtiisgmgelhleiivdrlkrefkvdanvgkpqvayret
    itkpvdvegkfirqtggrgqyghvkikveplprgsgfefvnaivggvipkeyipavqkgi
    eeamqsgpligfpvvdikvtlydgsyhevdssemafkiagsmaikeavqkgdpvilepim
    rvevttpeeymgdvigdlnarrgqilgmeprgnaqvirafvplaemfgyatdlrsktqgr
    gsfvmffdhyqevpkqvqeklik
    

    Sequence, based on observed residues (ATOM records): (download)
    >2efgA (A:)
    ydlkrlrnigiaahidagktttterilyytgriaavttcfwkdhriniidtpghvdftie
    versmrvldgaivvfdssqgvepqsetvwrqaekykvpriafankmdktgadlwlvirtm
    qerlgarpvvmqlpigredtfsgiidvlrmkaytygndlgtdireipipeeyldnareyh
    eklvevaadfdenimlkylegeepteeelvaairkgtidlkitpvflgsalknkgvqlll
    davvdylpspldippikgttpegevveihpdpngplaalafkimadpyvgrltfirvysg
    tltsgsyvynttkgrkervarllrmhanhreeveelkagdlgavvglketitgdtlvged
    aprvilesvgkpqvayretitkpvdvegkfirqtggrgqyghvkikveplprgsgfefvn
    aivggvipkeyipavqkgieeamqsgpligfpvvdikvtlydgsyhevdssemafkiags
    maikeavqkgdpvilepimrvevttpeeymgdvigdlnarrgqilgmeprgnaqvirafv
    plaemfgyatdlrsktqgrgsfvmffdhyqevpkqvqeklik