PDB entry 2efe

View 2efe on RCSB PDB site
Description: Ara7-GDPNH2/AtVps9a
Class: transport protein
Keywords: GEF, GTPase, Vps9, Rab5, nucleotide, TRANSPORT PROTEIN
Deposited on 2007-02-22, released 2008-02-26
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-12-21, with a file datestamp of 2011-12-16.
Experiment type: XRAY
Resolution: 2.08 Å
R-factor: 0.23
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Similarity to vacuolar protein sorting-associated protein VPS9
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Small GTP-binding protein-like
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2efeb_
  • Chain 'C':
    Compound: Similarity to vacuolar protein sorting-associated protein VPS9
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Small GTP-binding protein-like
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2efed_
  • Heterogens: GNH, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2efeB (B:)
    gsmaaagnksinaklvllgdvgagksslvlrfvkdqfvefqestigaaffsqtlavndat
    vkfeiwdtagqeryhslapmyyrgaaaaiivfdvtnqasferakkwvqelqaqgnpnmvm
    alagnksdlldarkvtaedaqtyaqenglffmetsaktatnvkeifyeiarrlprvqpte
    n
    

    Sequence, based on observed residues (ATOM records): (download)
    >2efeB (B:)
    sinaklvllgdvgagksslvlrfvkdqfvefqestigaaffsqtlavndatvkfeiwdta
    gqeryhslapmyyrgaaaaiivfdvtnqasferakkwvqelqaqgnpnmvmalagnksdl
    ldarkvtaedaqtyaqenglffmetsaktatnvkeifyeiarrlp
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2efeD (D:)
    gsmaaagnksinaklvllgdvgagksslvlrfvkdqfvefqestigaaffsqtlavndat
    vkfeiwdtagqeryhslapmyyrgaaaaiivfdvtnqasferakkwvqelqaqgnpnmvm
    alagnksdlldarkvtaedaqtyaqenglffmetsaktatnvkeifyeiarrlprvqpte
    n
    

    Sequence, based on observed residues (ATOM records): (download)
    >2efeD (D:)
    sinaklvllgdvgagksslvlrfvkdqfvefqestigaaffsqtlavndatvkfeiwdta
    gqeryhslapmyyrgaaaaiivfdvtnqasferakkwvqelqaqgnpnmvmalagnksdl
    ldarkvtaedaqtyaqenglffmetsaktatnvkeifyeiarrlp