PDB entry 2ef9

View 2ef9 on RCSB PDB site
Description: Structural and mechanistic changes along an engineered path from metallo to non-metallo KDO8P synthase
Class: transferase
Keywords: kdo, kdo8p, kdo8ps, pep, a5p, transferase
Deposited on 2007-02-22, released 2007-04-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.188
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-dehydro-3-deoxyphosphooctonate aldolase
    Species: Aquifex aeolicus [TaxId:63363]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O66496
      • engineered (9-10)
      • engineered (234)
      • engineered (236)
    Domains in SCOPe 2.07: d2ef9a_
  • Chain 'B':
    Compound: 2-dehydro-3-deoxyphosphooctonate aldolase
    Species: Aquifex aeolicus [TaxId:63363]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O66496
      • engineered (9-10)
      • engineered (234)
      • engineered (236)
    Domains in SCOPe 2.07: d2ef9b_
  • Heterogens: PEP, A5P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ef9A (A:)
    mekflviagmnaieseelllkvgeeikrlsekfkevefvfkssfdkanrssihsfrghgl
    eygvkalrkvkeefglkittdiheswqaepvaevadiiqipaflcrqtdlllaaaktgra
    vnvkkgqflapwdtknvveklkfggakeiyltergttfgynnlvvdfrslpimkqwakvi
    ydathsvqlpgglgdksggmrefifpliraavavgcdgvfmethpepekalsdaptalpl
    sqlegiieaileirevaskyyetipvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ef9A (A:)
    ekflviagmnaieseelllkvgeeikrlsekfkevefvfkssfdkanrssihsfrghgle
    ygvkalrkvkeefglkittdiheswqaepvaevadiiqipaflcrqtdlllaaaktgrav
    nvkkgqflapwdtknvveklkfggakeiyltergttfgynnlvvdfrslpimkqwakviy
    dathsvqlpgglgdksggmrefifpliraavavgcdgvfmethpepekalsdaptalpls
    qlegiieaileirevaskyyeti
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ef9B (B:)
    mekflviagmnaieseelllkvgeeikrlsekfkevefvfkssfdkanrssihsfrghgl
    eygvkalrkvkeefglkittdiheswqaepvaevadiiqipaflcrqtdlllaaaktgra
    vnvkkgqflapwdtknvveklkfggakeiyltergttfgynnlvvdfrslpimkqwakvi
    ydathsvqlpgglgdksggmrefifpliraavavgcdgvfmethpepekalsdaptalpl
    sqlegiieaileirevaskyyetipvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ef9B (B:)
    kflviagmnaieseelllkvgeeikrlsekfkevefvfkssfdkanrssihsfrghgley
    gvkalrkvkeefglkittdiheswqaepvaevadiiqipaflcrqtdlllaaaktgravn
    vkkgqflapwdtknvveklkfggakeiyltergttfgynnlvvdfrslpimkqwakviyd
    athsvqlpgglgdksggmrefifpliraavavgcdgvfmethpepekalsdaptalplsq
    legiieaileirevaskyyeti