PDB entry 2ee3

View 2ee3 on RCSB PDB site
Description: Solution structures of the fn3 domain of human collagen alpha-1(XX) chain
Class: signaling protein
Keywords: KIAA1510, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2007-02-15, released 2007-08-21
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Collagen alpha-1(XX) chain
  Species: Homo sapiens [TaxId:9606]
  Gene: COL20A1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9P218 (7-101)
    • expression tag (0-6)
    • expression tag (102-107)
  Domains in SCOPe 2.04: d2ee3a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2ee3A (A:)
  gssgssglapprhlgfsdvshdaarvfwegaprpvrlvrvtyvssegghsgqteapgnat
  samlgplsssttytvrvtclypgggsstltgrvttkkapspssgpssg