PDB entry 2edt

View 2edt on RCSB PDB site
Description: Solution structure of the ig-like domain (3449-3537) from human Obscurin
Class: contractile protein
Keywords: Obscurin-myosin light chain kinase, Obscurin-MLCK, Obscurin-RhoGEF, beta-sandwich, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, CONTRACTILE PROTEIN
Deposited on 2007-02-15, released 2007-08-21
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Obscurin
    Species: Homo sapiens [TaxId:9606]
    Gene: OBSCN
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5VST9 (7-95)
      • cloning artifact (0-6)
      • cloning artifact (96-101)
    Domains in SCOPe 2.05: d2edta_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2edtA (A:)
gssgssgpakfteglrneeavegatamlwcelskvapvewrkgpenlrdgdryilrqegt
rcelqicglamadageylcvcgqertsatltiralpsgpssg